Primary Antibodies

Recombinant human IL-1beta

<p>Rat monoclonal CD147 antibody (PE)</p>

Mouse monoclonal EPHX2 antibody

<p>Rabbit polyclonal ISG15 antibody (biotin)</p>

<p>Rabbit polyclonal DNAI2 antibody</p>

<p>Rabbit polyclonal CYP4Z1 antibody</p>

IFN gamma antibody was raised in mouse using human interferon beta as the immunogen.

<p>Rabbit polyclonal RRAGB antibody</p>

MCM4 antibody was raised using the N terminal of MCM4 corresponding to a region with amino acids SRVEGTPRSGVRGTPVRQRPDLGSAQKGLQVDLQSDGAAAEDIVASEQSL

<p>Rabbit Polyclonal 4EBP1 antibody</p>

<p>BLM Monoclonal Antibody (FITC)</p>

<p>LACRT antibody was raised in Rabbit using Human LACRT as the immunogen</p>

<p>HSPA2 antibody was raised in Rabbit using Human HSPA2 as the immunogen</p>

CC2D1A antibody was raised in Rabbit using Human CC2D1A as the immunogen

The GIRK1 antibody is a polyclonal antibody used in the field of Life Sciences. It specifically targets the GIRK1 protein, which plays a crucial role in various biological processes. This antibody can be used for research purposes to study the function and regulation of GIRK1.

<p>RBM38 antibody was raised using the middle region of RBM38 corresponding to a region with amino acids QYPYAASPATAASFVGYSYPAAVPQALSAAAPAGTTFVQYQAPQLQPDRM</p>

<p>PEX26 antibody was raised using the N terminal of PEX26 corresponding to a region with amino acids MKSDSSTSAAPLRGLGGPLRSSEPVRAVPARAPAVDLLEEAADLLVVHLD</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. With its bactericidal activity, it effectively treats tuberculosis infections by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase. This prevents transcription and replication, leading to the elimination of the infection. The active compounds in this drug have been extensively studied using advanced techniques like patch-clamp and transcription-quantitative polymerase chain. Metabolized through various transformations, including hydrolysis, oxidation, reduction, and conjugation, it specifically targets Mycobacterium tuberculosis strains and inhibits their growth. Experience the potent action of 6-Fluoro-3-indoxyl-beta-D-galactopyranoside for effective tuberculosis treatment.</p>

The OLIG2 antibody is a monoclonal antibody that specifically targets the TGF-beta protein. It has been extensively tested and proven to effectively neutralize the activity of TGF-beta in human serum. This antibody is widely used in Life Sciences research for various applications, including immunohistochemistry, western blotting, and flow cytometry.

Rabbit polyclonal PYGB antibody (biotin)

Rabbit polyclonal RNF212 antibody

<p>HGS antibody is a polyclonal antibody that specifically targets endosomes. This antibody is used in various applications, including immunological research and therapeutic purposes. It has been shown to have an inhibiting effect on the antigen-presenting function of endosomes, making it a valuable tool for studying immunomodulation. Additionally, HGS antibody has demonstrated antinociceptive properties, suggesting its potential use in pain management. With its wide range of applications and proven effectiveness, HGS antibody is a crucial component in the field of Life Sciences.</p>

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, ultimately inhibiting bacterial growth. Rigorous testing using the patch-clamp technique on human erythrocytes has revealed its high efficacy in combating tuberculosis. Additionally, it undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Notably, it also exhibits specific binding to markers expressed at high levels in Mycobacterium tuberculosis strains and effectively inhibits cell growth in culture.

<p>The Catalase antibody is a powerful tool used in various research applications. It is available in both polyclonal and monoclonal forms, providing researchers with options based on their specific needs. This antibody is highly specific and has been extensively validated for use in immunoassays.</p>

<p>ApoBEC3D antibody was raised using a synthetic peptide corresponding to a region with amino acids SYTWLCYEVKIKRGRSNLLWDTGVFRGPVLPKRQSNHRQEVYFRFENHAE</p>

<p>The HER3 antibody is a monoclonal antibody known as trastuzumab. It is used in the treatment of certain types of cancer, specifically those that overexpress the HER2 protein. This antibody works by binding to the HER2 receptor on cancer cells, blocking its activity and inhibiting cell growth. The HER3 antibody has been extensively studied and shown to have a high affinity for the HER2 receptor, making it an effective targeted therapy option. In addition, it has also been found to have potential therapeutic applications in other conditions such as autoimmune disorders and cardiovascular diseases. With its specificity and ability to bind to specific targets, the HER3 antibody offers promising possibilities for personalized medicine and targeted treatments.</p>

<p>The CKLF1 antibody is a highly specialized monoclonal antibody that has been specifically designed to target and neutralize the activated form of CKLF1. This antibody is widely used in the field of Life Sciences for various research purposes, including the study of autoimmune diseases and the development of therapeutic interventions.</p>

The Calcitonin antibody is a Monoclonal Antibody that is used as a diagnostic agent in drug preparation. It is designed to specifically target and neutralize calcitonin, a hormone involved in regulating calcium levels in the body. This antibody has been extensively characterized using mass spectroscopy and has been shown to have low density with a high number of acid residues, making it an ideal candidate for surface modification in various Life Sciences applications. In addition, electrochemical impedance spectroscopy has been used to study the binding kinetics of this antibody to calcitonin, further confirming its specificity and efficacy. Whether you are conducting research or developing new therapies, the Calcitonin antibody is an essential tool for your laboratory.

<p>Rabbit polyclonal BTF3 antibody (FITC)</p>

Mouse monoclonal HARS2 antibody

LSM14A antibody was raised in Rabbit using Human LSM14A as the immunogen

Rat monoclonal CD86 antibody (biotin)

<p>The B7H4 antibody is a highly effective medicament that belongs to the class of monoclonal antibodies. It is widely used in the field of Life Sciences for its remarkable properties. The antibody complex specifically targets and binds to B7H4, a protein expressed on the surface of various cancer cells, including MDA-MB-231 breast cancer cells. This binding inhibits the growth and proliferation of cancer cells by interfering with their signaling pathways.</p>

<p>KIAA0427 antibody was raised using the N terminal of KIAA0427 corresponding to a region with amino acids QVQGLLADKTEGDGESERTQSHISQWTADCSEPLDSSCSFSRGRAPPQQN</p>

<p>The RPA2 antibody is a highly specific monoclonal antibody that targets acid residues in proteins. It is widely used in life sciences research, particularly in the field of erbb2 inhibition and growth factor signaling. This antibody has been shown to have interferon-like activity and can bind to multiple targets simultaneously, making it a valuable tool in various experimental settings. The RPA2 antibody is commonly used for immunoprecipitation, Western blotting, and flow cytometry applications. Its high affinity and specificity ensure accurate and reliable results. With its unique properties and versatility, the RPA2 antibody is an essential tool for researchers studying protein-protein interactions, signal transduction pathways, and apoptosis-inducing factors.</p>

C4d Complement fragment Monoclonal Antibody (FITC)

Rabbit polyclonal CD3E antibody (biotin)

Mouse monoclonal Lamin A/C antibody

<p>Purified Polyclonal POLR3K antibody</p>

<p>Calmodulin antibody was raised in mouse using calmodulin purified from Dictyostelium discoideum as the immunogen.</p>

<p>The FABP3 antibody is a highly specialized monoclonal antibody that plays a crucial role in various biological processes. It acts as a growth factor and is involved in the immobilization of biomolecules. This antibody specifically targets FABP3, also known as alpha-fetoprotein, which is found in human serum. By binding to FABP3, this antibody exhibits cytotoxic effects, making it a valuable tool in research and diagnostics within the Life Sciences field. Its unique composition and histidine amide structure allow for precise targeting and efficient detection of FABP3. Whether you're conducting experiments or developing new therapies, the FABP3 antibody is an essential component for your scientific endeavors.</p>

<p>FBXO24 antibody was raised using the N terminal of FBXO24 corresponding to a region with amino acids MGEKAVPLLRRRRVKRSCPSCGSELGVEEKRGKGNPISIQLFPPELVEHI</p>

<p>Rabbit polyclonal Eif4g antibody (Ser1108)</p>

<p>Mouse monoclonal KIAA1609 antibody</p>

<p>Mouse monoclonal NEUROG1 antibody</p>

<p>Rabbit polyclonal RCAN1 antibody</p>

<p>The RCC1 antibody is a crucial tool in the field of Life Sciences. It is an autoantibody that specifically targets RCC1, a nuclear protein involved in cell cycle regulation. This antibody is widely used as a research tool to study the function and localization of RCC1 in various cellular processes. The RCC1 antibody is available as both polyclonal and monoclonal antibodies, allowing researchers to choose the most suitable option for their experiments. It has been extensively validated for its specificity and sensitivity, making it a reliable tool for detecting and quantifying RCC1 levels in different samples. Whether you are studying cell division, chromatin organization, or other related processes, the RCC1 antibody is an essential component of your research toolkit.</p>

Purified Polyclonal Serpin A1 antibody

<p>Mouse brain antibody (FITC) was raised in rabbit using brain tissue from C3H mice as the immunogen.</p>

<p>The GPR158 antibody is a monoclonal antibody that specifically targets GPR158, a cationic receptor involved in various biological processes. This antibody has been extensively tested and validated for its specificity and effectiveness in scientific research. It can be used in a wide range of applications, including immunohistochemistry, Western blotting, and ELISA.</p>

LCK antibody was raised in Rabbit using Human LCK as the immunogen

LTBR antibody was raised in Rabbit using Human LTBR as the immunogen

Rabbit polyclonal AP4E1 antibody

Rabbit polyclonal SLC20A1 antibody

<p>IFT81 antibody was raised in Rabbit using Human IFT81 as the immunogen</p>

<p>Rabbit polyclonal RPS21 antibody</p>

<p>IWS1 antibody was raised in Rabbit using Human IWS1 as the immunogen</p>

<p>The CLIC6 antibody is a highly specific monoclonal antibody that targets β-catenin, a key protein involved in various cellular processes. This antibody has been developed using cutting-edge technology and has shown exceptional binding affinity and specificity for β-catenin. It is derived from Gynura procumbens, a plant known for its medicinal properties.</p>

<p>Mouse monoclonal KIAA0495 antibody</p>

<p>Rabbit polyclonal TRIM6 antibody</p>

<p>Mouse monoclonal PDE1B antibody</p>

<p>The PER2 antibody is a highly versatile and effective tool in the field of life sciences. It belongs to the class of polyclonal antibodies and monoclonal antibodies, making it suitable for a wide range of applications. This antibody specifically targets the PER2 protein, which plays a crucial role in regulating circadian rhythms and biological processes.</p>

The MMP9 antibody is a powerful tool in the field of Life Sciences. This polyclonal antibody specifically targets and binds to matrix metalloproteinase 9 (MMP9), an enzyme involved in various biological processes. MMP9 plays a crucial role in tissue remodeling, collagen degradation, and extracellular matrix breakdown.

<p>BSG antibody is a monoclonal antibody that specifically targets tumor necrosis factor-alpha (TNF-α), a cytokine involved in inflammation and immune response. This antibody has been shown to neutralize the activity of TNF-α, reducing its pro-inflammatory effects. Additionally, BSG antibody has been found to inhibit the accumulation of amyloid proteins, which are associated with neurodegenerative diseases such as Alzheimer's disease. It also reduces the production of reactive oxygen species and superoxide, which can cause oxidative damage to cells. Furthermore, BSG antibody has been shown to block the activity of interleukin-6 (IL-6), another pro-inflammatory cytokine. This monoclonal antibody is highly specific and reactive towards its target, making it an effective tool in research and therapeutic applications.</p>

<p>Septin 9 antibody was raised using the C terminal of 40430 corresponding to a region with amino acids HCEFAYLRDLLIRTHMQNIKDITSSIHFEAYRVKRLNEGSSAMANGMEEK</p>

<p>Mouse monoclonal TOMM34 antibody</p>

<p>MAP4K2 antibody was raised in Rabbit using Human MAP4K2 as the immunogen</p>

<p>Mouse monoclonal VWA5A antibody</p>

<p>TSHR antibody is a monoclonal antibody that acts as an inhibitor of the epidermal growth factor family kinase. It specifically targets and binds to the thyroid-stimulating hormone receptor (TSHR) in the nucleus, preventing its activation by autoantibodies. This antibody has been shown to exhibit cytotoxic effects on cells expressing TSHR, inhibiting their growth and proliferation. Additionally, it has been found to modulate the activity of transforming growth factor-beta 1 (TGF-β1), a potent growth factor involved in various cellular processes. TSHR antibody is available in both monoclonal and polyclonal forms, providing researchers with options for their specific experimental needs. Its use has also been associated with reduced superoxide production and protection against thrombocytopenia. With its ability to target TSHR and influence key signaling pathways, this antibody holds great potential for research in the fields of thyroid biology, autoimmune diseases, and cancer therapy.</p>

<p>Rabbit polyclonal CRABP2 antibody</p>

Mouse monoclonal SHPK antibody

<p>The HSP60 antibody is a highly specific polyclonal antibody that targets heat shock protein 60 (HSP60). This antibody is commonly used in research and diagnostic applications to detect the presence of HSP60 in various samples, including adipose tissue. HSP60 is a chaperone protein that plays a crucial role in cellular processes such as protein folding and transport.</p>

MINCLE antibody was raised in mouse using recombinant human MINCLE (41-219aa) purified from E.coli as the immunogen.

Mouse monoclonal PRKAR1B antibody

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is specifically designed to target tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. The effectiveness of this drug has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. In addition to its potent antibacterial properties, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside specifically targets markers expressed in Mycobacterium tuberculosis strains and effectively inhibits their growth in</p>

<p>The His Tag Polyclonal antibody is a valuable tool in Life Sciences research. This antibody specifically targets proteins that are tagged with a histidine (His) tag, allowing for easy detection and purification of these proteins. The antibody can be used in various applications such as immunoassays, Western blotting, and protein-protein interaction studies.</p>

<p>MRPL9 antibody was raised in Rabbit using Human MRPL9 as the immunogen</p>

<p>The SERPING1 antibody is a highly specialized product used in the field of Life Sciences. It is an aldehyde that specifically targets and interacts with human serum antigens. This monoclonal antibody has been extensively researched and developed to detect and measure the presence of atrial natriuretic peptide (ANP) in low-density samples.</p>

<p>Mouse monoclonal Sialosyl-Tn antigen antibody (FITC)</p>

<p>Rabbit polyclonal VPS52 antibody</p>

Trichomonas vaginalis antibody was raised in mouse using Trichomonas vaginalis as the immunogen.

TMEFF2 antibody is an immunogenic composition that targets the TMEFF2 protein, which is found in humans. This antibody has been shown to have cytotoxic and antiviral properties, making it a valuable tool in research and clinical applications. It interacts with the TMEFF2 protein through an antigen-antibody reaction, leading to the formation of a complex that can be detected using techniques such as colloidal gold or fluorescent labeling. The TMEFF2 antibody has also been used to study the role of this protein in various biological processes, including cell growth and differentiation. With its high specificity and reactivity, this antibody is a valuable tool for scientists in the Life Sciences field.

The IDS antibody is a highly specialized product used in various assays in the field of Life Sciences. This monoclonal antibody specifically targets and detects antigens such as anti-HBs, globulin, fatty acid, transferrin, interferon, and cyclase-activating antibodies. It is designed to provide accurate and reliable results in research and diagnostic applications.

MGMT antibody was raised using the middle region of MGMT corresponding to a region with amino acids ISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGG

<p>Mouse monoclonal ECI2 antibody</p>

Mouse monoclonal C16orf72 antibody

<p>Mouse monoclonal DR5 antibody (biotin)</p>

Mouse monoclonal ANXA4 antibody

The STAT5A antibody is a highly specialized product in the field of Life Sciences. It is an essential tool for researchers studying fatty acid metabolism, as it allows for the detection and analysis of STAT5A protein levels in various biological samples. This monoclonal antibody specifically targets STAT5A, a transcription factor that plays a crucial role in mediating cellular responses to cytokines such as interferon and tumor necrosis factor-alpha (TNF-α). By neutralizing STAT5A activity, this antibody can help researchers gain insights into the regulation of gene expression and signaling pathways involved in immune responses and cell growth.

<p>BHMT antibody was raised in mouse using recombinant human BHMT (1-406aa) purified from E. coli as the immunogen.</p>

<p>MAOA antibody is a monoclonal antibody that specifically targets the enzyme monoamine oxidase A (MAOA). This antibody plays a crucial role in regulating the levels of neurotransmitters such as serotonin, norepinephrine, and dopamine. By binding to MAOA, this antibody inhibits its activity and leads to an increase in the levels of these neurotransmitters.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting and inhibiting bacterial growth. By binding to DNA-dependent RNA polymerase, this drug prevents transcription and replication, effectively stopping the spread of the infection. Additionally, it has been proven to be highly effective in human erythrocytes through patch-clamp techniques. Metabolically, it undergoes various transformations such as hydrolysis, oxidation, reduction, and conjugation with glucuronic acid. Its ability to bind to markers expressed in Mycobacterium tuberculosis strains further enhances its bactericidal activity. With its multifaceted approach to fighting tuberculosis, the 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a promising solution for patients in need.</p>

<p>Purified Polyclonal Kallikrein 3 antibody</p>

<p>Purified Polyclonal GPR182 antibody</p>

<p>The CES2 antibody is a polyclonal antibody that is used in immunohistochemistry to detect the presence of CES2 antigen. It can be immobilized on an electrode and activated to bind specifically to CES2 antigen. This antibody has been shown to have high specificity and sensitivity in detecting CES2 expression in various tissues. CES2 is an enzyme that plays a crucial role in drug metabolism, including the activation of prodrugs and the detoxification of xenobiotics. It has also been implicated in interferon signaling and chemokine regulation. The CES2 antibody is widely used in life sciences research to study the function and localization of CES2 protein in different biological systems, including transthyretin-related diseases and CXCR4-mediated processes.</p>

<p>Salmonella typhi Monoclonal Antibody BSA/Azide Free</p>

<p>The BAK antibody is a highly reactive monoclonal antibody that targets the growth factor histidine. It is specifically designed to bind to collagen and epidermal growth factor, making it an effective tool for research in the field of Life Sciences. Additionally, this antibody has shown strong binding affinity towards anti-mesothelin, TGF-beta1, steroid, erythropoietin, and glutamate. With its ability to detect and neutralize autoantibodies, the BAK antibody is an invaluable asset for any laboratory or research facility. Trust in its reliability and specificity to enhance your experiments and advance scientific knowledge.</p>

Myoglobin antibody was raised in mouse using human cardiac myoglobin as the immunogen.

KARS antibody was raised using the C terminal of KARS corresponding to a region with amino acids GMGIDRVAMFLTDSNNIKEVLLFPAMKPEDKKENVATTDTLESTTVGTSV

<p>Transglutaminase 5 antibody was raised using the C terminal of TGM5 corresponding to a region with amino acids VLKPQHQASIILETVPFKSGQRQIQANMRSNKFKDIKGYRNVYVDFAL</p>