Primary Antibodies

Goat anti-human IgG (H+L) was raised in goat using human IgG whole molecule as the immunogen.

The Myc antibody is a highly versatile and potent tool in the field of life sciences. It is an antibody that specifically targets and binds to the Myc protein, which plays a crucial role in various cellular processes such as cell growth, proliferation, and differentiation. The Myc antibody can be used for a wide range of applications including immunohistochemistry, western blotting, flow cytometry, and immunoprecipitation.

This antibody reacts with heavy chains on Goat IgG and light chains on all Goat immunoglobulins.

GRHL3 antibody was raised in rabbit using the C terminal of GRHL3 as the immunogen

<p>CHRM3 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

Goat anti Mouse IgG (H + L) (rhodamine) secondary antibody

The LCK antibody is a monoclonal antibody that belongs to the class of antibodies. It has inhibitory properties against neurotrophic factors and tumor necrosis factor-alpha (TNF-α). This antibody specifically targets LCK, a protein kinase that plays a crucial role in T-cell activation and immune response. The LCK antibody can be used in various life science applications such as immunoassays, nuclear immobilization, and as an inhibitor for chemokine signaling pathways. It is highly specific and reliable, making it an essential tool for researchers in the field of immunology and molecular biology. With its high-quality production and performance, this antibody ensures accurate and reproducible results in your experiments.

GPR174 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

Donkey anti-rabbit IgG (H+L) (Alk Phos) was raised in donkey using rabbit IgG whole molecule as the immunogen.

The Chk2 antibody is a highly specialized monoclonal antibody that plays a crucial role in various biological processes. It specifically targets Chk2, a protein involved in cell cycle checkpoints and DNA damage response. This antibody has been extensively studied in the field of Life Sciences and has shown great potential for therapeutic applications.

<p>The Zopiclone antibody is a monoclonal antibody that has cytotoxic properties. It targets interleukin-6, a transmembrane conductance protein involved in human chemokine signaling. This antibody can be used in Life Sciences research to study the effects of IL-6 on various cellular processes. Additionally, it can be used as a medicament for the treatment of diseases related to IL-6 dysregulation. The Zopiclone antibody is also effective against oncogenic kinases and cysteine-rich proteins, making it a valuable tool for cancer research. Furthermore, it has been shown to enhance the activity of histone deacetylase inhibitors and inhibit the production of TNF-α, an inflammatory cytokine. With its specific targeting capabilities and diverse applications, the Zopiclone antibody is an essential component in the field of Antibodies and monoclonal antibodies.</p>

<p>The HDAC8 antibody is a highly specific monoclonal antibody that targets the histone deacetylase 8 (HDAC8) protein. This antibody has been extensively validated and is widely used in life sciences research. HDAC8 plays a crucial role in regulating gene expression by removing acetyl groups from histones, thereby affecting chromatin structure and gene transcription. The HDAC8 antibody can be used in various applications, including Western blotting, immunohistochemistry, and immunofluorescence, to study the expression and localization of HDAC8 in different tissues and cell types. It has been shown to specifically bind to HDAC8 without cross-reactivity with other HDAC isoforms or related proteins. This antibody is an essential tool for researchers studying epigenetics, cancer biology, and drug discovery targeting HDACs.</p>

This antibody reacts with heavy chains on Goat IgG.

Rabbit polyclonal Pichia Pastoris antibody

<p>NKX6-3 antibody was raised in rabbit using the N terminal of NKX6-3 as the immunogen</p>

Digoxin antibody is a type of antibody that specifically targets digoxin, a medication used to treat heart conditions. It is available in both monoclonal and polyclonal forms. This antibody binds to digoxin molecules, preventing them from exerting their effects on the body. Digoxin antibody has been shown to have pro-angiogenic activity, meaning it promotes the growth of new blood vessels. It also interacts with annexin A2, a protein involved in cell signaling and angiogenesis. Additionally, this antibody has antiangiogenic properties, meaning it inhibits the formation of new blood vessels. Overall, digoxin antibody plays a crucial role in regulating the effects of digoxin and has potential applications in various fields within life sciences research.

<p>ITGA4 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>SLC12A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids MPHFTVVPVDGPRRGDYDNLEGLSWVDYGERAELDDSDGHGNHRESSPFL</p>

CACHD1 antibody was raised using the N terminal of CACHD1 corresponding to a region with amino acids HKFRCKGSYEHRSRPIYVSTVRPQSKHIVVILDHGASVTDTQLQIAKDAA

<p>The STAT1 antibody is a highly specialized antibody used in the field of Life Sciences. It is designed to target and bind to the STAT1 protein, which plays a crucial role in cellular signaling pathways. This antibody can be used for various applications such as immunohistochemistry, western blotting, and flow cytometry.</p>

Rabbit anti-dog IgG (Alk Phos) was raised in rabbit using canine IgG F(c) fragment as the immunogen.

RNF34 antibody was raised in rabbit using the middle region of RNF34 as the immunogen

Goat anti-human IgG was raised in goat using human IgG F(ab')2 fragment as the immunogen.

<p>The GFAP antibody is a polyclonal antibody that specifically targets glial fibrillary acidic protein (GFAP). It is commonly used in the field of Life Sciences for various research applications. This antibody recognizes and binds to GFAP, which is an intermediate filament protein found mainly in astrocytes. By targeting GFAP, researchers can study the role of astrocytes in different physiological and pathological conditions.</p>

ZMYND11 antibody was raised in rabbit using the middle region of ZMYND11 as the immunogen

This antibody reacts with heavy (gamma) chains on rat IgG and light chains on all rat immunoglobulins.

<p>Rat thymocyte antibody was raised in rabbit using RBC-free rat thymocytes as the immunogen.</p>

The Merlin antibody is a highly specialized monoclonal antibody that targets specific proteins involved in various physiological processes. It has been shown to have a significant impact on the regulation of erythropoietin and endothelial growth factor, both of which play crucial roles in cell growth and development. Additionally, the Merlin antibody has been found to interact with androgen receptors, modulating their activity and influencing hormone response.

<p>GPR61 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

SCG3 antibody was raised in rabbit using the C terminal of SCG3 as the immunogen

MRGPRX2 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.

This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.

SIAH1 antibody was raised in rabbit using the C terminal of SIAH1 as the immunogen

Rabbit anti-rat IgG (H+L) (Rhodamine) was raised in rabbit using rat IgG whole molecule as the immunogen.

<p>The RAF1 antibody is a monoclonal antibody that specifically targets elastase, an enzyme involved in the breakdown of proteins. It has been extensively studied in the field of Life Sciences and is widely used in research and diagnostic applications. This antibody can be used to detect elastase levels in various biological samples, including human serum. Additionally, it has been shown to have potential therapeutic applications, such as inhibiting the action of elastase in conditions like pancreatitis or chronic obstructive pulmonary disease (COPD). The RAF1 antibody can also be used in combination with other antibodies, such as insulin or anti-VEGF antibodies, to study the interactions between different growth factors and signaling pathways. Its versatility and specificity make it a valuable tool for scientists and researchers working in diverse areas of biomedical research.</p>

This antibody reacts with heavy chains on Goat IgG and light chains on all Goat immunoglobulins.

<p>HS3ST5 antibody was raised using a synthetic peptide corresponding to a region with amino acids SQYNLYFNATRGFYCLRFNIIFNKCLAGSKGRIHPEVDPSVITKLRKFFH</p>

DFFA antibody was raised in rabbit using the N terminal of DFFA as the immunogen

ERBB2 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

Bcat1 antibody was raised in rabbit using the C terminal of Bcat1 as the immunogen

Fas antibody is a highly specialized inhibitor that targets Fas-mediated apoptosis. It works by blocking the interaction between Fas and its ligand, preventing cell death signaling. This antibody has been extensively studied in various research fields, including epidermal growth factor signaling, histidine metabolism, and α-synuclein aggregation.

GPR52 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

Rabbit anti-mouse kappa chain was raised in rabbit using murine kappa light chain fragment as the immunogen.

<p>The p53 antibody is a monoclonal antibody that targets the p53 protein, which plays a crucial role in regulating cell growth and preventing tumor formation. This antibody specifically binds to the p53 protein and can be used for various applications in Life Sciences research.</p>

<p>Rabbit anti-mouse kappa chain (Alk Phos) was raised in rabbit using murine kappa light chain as the immunogen.</p>

p0071 antibody was raised in Guinea Pig using a synthetic peptide cocktail of human p0071 as the immunogen.

Rabbit polyclonal LPAM1 antibody

WNK1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

<p>Rabbit anti-sheep IgG (H+L) (biotin) was raised in rabbit using sheep IgG whole molecule as the immunogen.</p>

CD11c antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

ZNF326 antibody was raised in rabbit using the C terminal of ZNF326 as the immunogen

<p>GPR37L1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

The ATF2 antibody is a polyclonal antibody that specifically targets the nuclear protein ATF2. This protein plays a crucial role in various cellular processes, including gene regulation and cell growth. The ATF2 antibody is commonly used in life sciences research to study the interaction between ATF2 and other proteins such as β-catenin and histone H3. It can be used in immunohistochemistry, western blotting, and other techniques to detect the presence of ATF2 in different tissues and cell types. Additionally, this antibody has been shown to have potential therapeutic applications in diseases such as cancer, where aberrant ATF2 activity is often observed. With its high specificity and sensitivity, the ATF2 antibody is a valuable tool for researchers studying cellular signaling pathways and protein interactions.

<p>Keratin K73 antibody was raised in Guinea Pig using synthetic peptide of human keratin K73 coupled to KLH as the immunogen.</p>

HSPB1 antibody was raised in rabbit using the C terminal of HSPB1 as the immunogen

IL1RL2 antibody was raised in rabbit using the N terminal of IL1RL2 as the immunogen

The Caveolin 1 antibody is a polyclonal antibody that specifically targets the Caveolin 1 protein. This protein is found in the cell membrane and plays a crucial role in various cellular processes. The Caveolin 1 antibody can be used in research and diagnostic applications to study the function and localization of this protein.

SPZ1 antibody was raised in rabbit using the C terminal of SPZ1 as the immunogen

GABRA2 antibody was raised in rabbit using the middle region of GABRA2 as the immunogen

Goat anti-human kappa chain (Fab'2) was raised in goat using human kappa light chain as the immunogen.

MBNL2 antibody was raised in rabbit using the middle region of MBNL2 as the immunogen

Rabbit polyclonal HDAC4/HDAC5/HDAC9 antibody

Mouse monoclonal Benzoylecgonine/Cocaine antibody

MAS1 antibody was raised using the middle region of MAS1 corresponding to a region with amino acids VIIFIAILSFLVFTPLMLVSSTILVVKIRKNTWASHSSKLYIVIMVTIII

MESP2 antibody was raised in rabbit using the C terminal of MESP2 as the immunogen

<p>HSP90AB1 antibody was raised in rabbit using the N terminal of HSP90AB1 as the immunogen</p>

The Tyrosine Hydroxylase antibody is a highly specific and potent monoclonal antibody that targets the tyrosine hydroxylase enzyme. This enzyme is involved in the synthesis of dopamine, a neurotransmitter that plays a crucial role in various physiological processes. The antibody has been extensively tested and validated for its ability to neutralize the activity of tyrosine hydroxylase, making it an invaluable tool for researchers in the field of Life Sciences.

<p>Rabbit anti-human IgG was raised in rabbit using human IgG F(c) fragment as the immunogen.</p>

Purified Polyclonal MKK2 antibody

The beta Amyloid antibody is a highly effective and versatile product that offers a range of benefits in the field of Life Sciences. It is a Polyclonal Antibody that has been specifically designed to target and neutralize the beta-amyloid protein, which is associated with neurodegenerative diseases such as Alzheimer's.

CK1 delta antibody was raised in goat using residues 310-327 of human casein kinase 1d located at the C-terminus as the immunogen.

MAPK14 antibody was raised in rabbit using the C terminal of MAPK14 as the immunogen

This antibody reacts with heavy chains on human IgG (gamma chain).

<p>Peptide YY antibody was raised in guinea pig using synthetic porcine peptide TT as the immunogen.</p>

Mkx antibody was raised in rabbit using the C terminal of Mkx as the immunogen

The Caspase 3 antibody is a highly effective and cytotoxic medicament used in the field of Life Sciences. This antibody, available in both polyclonal and monoclonal forms, is specifically designed to target and neutralize activated caspase 3 proteins. By binding to these proteins, the Caspase 3 antibody effectively inhibits their activity, preventing cell death and promoting cell survival.

<p>Goat anti-human IgG (H+L) (Alk Phos) was raised in goat using human IgG, whole molecule as the immunogen.</p>

<p>SLC11A2 antibody was raised using the N terminal Of Slc11A2 corresponding to a region with amino acids VLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYF</p>

HTR7 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

The mTOR antibody is a highly specialized product used in the field of life sciences. It belongs to the category of antibodies and is specifically designed to target the mammalian target of rapamycin (mTOR). This antibody plays a crucial role in regulating various cellular processes such as cell growth, proliferation, and survival.

<p>Mouse anti Rat IgG2b secondary antibody</p>

Met antibody is a polyclonal antibody that targets the Met receptor, also known as hepatocyte growth factor receptor (HGFR). This antibody specifically binds to the extracellular domain of the Met receptor and inhibits its activation. The Met receptor plays a crucial role in cell proliferation, survival, migration, and angiogenesis. It is involved in various physiological processes such as tissue regeneration, embryonic development, and wound healing. Dysregulation of the Met receptor has been implicated in various diseases, including cancer.

<p>The GluR1 antibody is a monoclonal antibody that specifically targets the GluR1 subunit of the glutamate receptor. This antibody is widely used in Life Sciences research to study the role of GluR1 in various cellular processes. It has been shown to inhibit the activity of GluR1, leading to a decrease in tyrosine phosphorylation and subsequent downstream signaling events. Additionally, the GluR1 antibody has neutralizing properties against tumor necrosis factor-alpha (TNF-α), epidermal growth factor (EGF), and other growth factors. It can also be used as an inhibitor of lipoprotein lipase and anti-HER2 antibody. With its high specificity and potent inhibitory effects, the GluR1 antibody is an invaluable tool for researchers studying cellular signaling and related pathways.</p>

Complement C7 antibody was raised in goat using highly purified human complement protein as the immunogen.

<p>This antibody reacts with heavy chains on Guinea Pig IgG and light chains on all Guinea Pig immunoglobulins.</p>

<p>Goat anti-human IgG (H+L) was raised in goat using human IgG whole molecule as the immunogen.</p>

This antibody reacts with heavy chains on human IgA (alpha chain) and.

This antibody reacts with heavy chains on human IgA + IgG + IgM and light chains on all human immunoglobulins.

GPR151 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

<p>This antibody reacts with heavy (mu) chains on mouse IgM.</p>

<p>The TRPC6 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the tyrosine kinase receptor TRPC6, which plays a crucial role in cellular signaling and growth factor regulation. By binding to the receptor, this antibody inhibits its activity, preventing downstream signaling events.</p>

<p>The Glutamate receptor 2 antibody is a highly reactive monoclonal antibody that is used in life sciences research. It specifically targets the glutamate receptors present in various protein isoforms. The antibody works by binding to the receptors and disrupting protein-protein interactions, thus inhibiting the activation of colony-stimulating factors. This leads to a reduction in cytotoxic effects and promotes the pluripotency of cells. The Glutamate receptor 2 antibody is produced using recombinant vaccinia technology, ensuring high purity and specificity. Additionally, it forms a stable disulfide bond with its target, resulting in long-lasting and reliable results. Researchers can rely on this monoclonal antibody for accurate detection and analysis of β-catenin signaling pathways.</p>

Human RBC antibody was raised in rabbit using human erythrocytes as the immunogen.

This antibody reacts with heavy chains on human IgG (gamma chain) and light chains on all human immunoglobulins.

The Methyltestosterone antibody is a polyclonal antibody that specifically targets the nuclear hormone receptor for dopamine. It is commonly used in life sciences research to study the role of dopamine in various physiological processes. This antibody can be used in experiments such as immunohistochemistry and western blotting to detect and quantify the expression of the dopamine receptor in different tissues and cell types. Additionally, it can also be used to investigate the effects of dopamine on adipocyte function and metabolism. The Methyltestosterone antibody is a valuable tool for researchers studying the role of dopamine in health and disease.

Goat anti-cat IgG was raised in goat using feline IgG F(c) fragment as the immunogen.

<p>Goat anti-cat IgG (FITC) was raised in goat using feline IgG F(ab')2 fragment as the immunogen.</p>

<p>PRDM13 antibody was raised in rabbit using the C terminal of PRDM13 as the immunogen</p>

Goat anti-rat IgG/IgA/IgM (H+L) (FITC) was raised in goat using rat IgG, IgA and IgM whle molecules as the immunogen.