Primary Antibodies

This antibody reacts with heavy chains on human IgG (gamma chain) and light chains on all human immunoglobulins.

The c-Jun antibody is a highly specialized antibody that targets the nuclear factor kappa-light-chain-enhancer in cells. It plays a crucial role in regulating gene expression and cell growth. This antibody specifically recognizes and binds to c-Jun, an endonuclease involved in the mitogen-activated protein (MAP) kinase pathway. It has been extensively studied in various fields of Life Sciences, including cancer research and developmental biology.

This antibody reacts with heavy chains on llama IgG and light chains on all llama immunoglobulins.

The Halofuginone antibody is a water-soluble compound that belongs to the group of Polyclonal and monoclonal antibodies. It is widely used in Life Sciences for its pharmacologic properties. This antibody specifically targets and reacts with the 13-acetate form of Halofuginone, an epidermal growth factor inhibitor. The unique formulation of this antibody ensures high specificity and sensitivity in various applications, such as enzyme-linked immunosorbent assay (ELISA), Western blotting, immunohistochemistry, and more. With its exceptional performance and reliability, the Halofuginone antibody is an essential tool for researchers studying autoimmune diseases, cancer biology, and signal transduction pathways.

Rabbit anti-rat IgG was raised in rabbit using rat IgG F(c) fragment as the immunogen.

GABRR2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SNKSMTFDGRLVKKIWVPDVFFVHSKRSFTHDTTTDNIMLRVFPDGHVLY

Keratin K16 antibody was raised in Guinea Pig using synthetic peptide of human keratin K16 coupled to KLH as the immunogen.

This antibody reacts with heavy (gamma) chains on rat IgG and light chains on all rat immunoglobulins.

Sheep anti-rabbit IgG (H+L) was raised in sheep using rabbit IgG whole molecule as the immunogen.

This antibody reacts with heavy (gamma) chains on rat IgG and light chains on all rat immunoglobulins.

Rabbit polyclonal NFKB-p65 antibody

This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.

PLA2G3 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the rifamycins class. It is specifically designed to combat tuberculosis infection by targeting active compounds and exerting bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication, thus preventing bacterial growth. Its efficacy has been demonstrated through rigorous testing using the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it exhibits high affinity for markers expressed in Mycobacterium tuberculosis strains and effectively inhibits their growth in culture.

The GluR1 antibody is a monoclonal antibody that specifically targets the GluR1 subunit of the glutamate receptor. This antibody is widely used in Life Sciences research to study the role of GluR1 in various cellular processes. It has been shown to inhibit the activity of GluR1, leading to a decrease in tyrosine phosphorylation and subsequent downstream signaling events. Additionally, the GluR1 antibody has neutralizing properties against tumor necrosis factor-alpha (TNF-α), epidermal growth factor (EGF), and other growth factors. It can also be used as an inhibitor of lipoprotein lipase and anti-HER2 antibody. With its high specificity and potent inhibitory effects, the GluR1 antibody is an invaluable tool for researchers studying cellular signaling and related pathways.

This antibody reacts with heavy chains on Guinea Pig IgG and light chains on all Guinea Pig immunoglobulins.

Goat anti-human IgG (H+L) was raised in goat using human IgG whole molecule as the immunogen.

This antibody reacts with heavy (mu) chains on mouse IgM.

The TRPC6 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the tyrosine kinase receptor TRPC6, which plays a crucial role in cellular signaling and growth factor regulation. By binding to the receptor, this antibody inhibits its activity, preventing downstream signaling events.

The Glutamate receptor 2 antibody is a highly reactive monoclonal antibody that is used in life sciences research. It specifically targets the glutamate receptors present in various protein isoforms. The antibody works by binding to the receptors and disrupting protein-protein interactions, thus inhibiting the activation of colony-stimulating factors. This leads to a reduction in cytotoxic effects and promotes the pluripotency of cells. The Glutamate receptor 2 antibody is produced using recombinant vaccinia technology, ensuring high purity and specificity. Additionally, it forms a stable disulfide bond with its target, resulting in long-lasting and reliable results. Researchers can rely on this monoclonal antibody for accurate detection and analysis of β-catenin signaling pathways.

Goat anti-cat IgG (FITC) was raised in goat using feline IgG F(ab')2 fragment as the immunogen.

The p70S6 Kinase antibody is a highly specialized protein kinase that plays a crucial role in various cellular processes. It is involved in the regulation of cell growth, proliferation, and protein synthesis. This antibody specifically targets the p70S6 Kinase protein and can be used for research purposes.

TFE3 antibody is a highly specific antibody that targets the TFE3 protein, which is involved in regulating gene expression. This antibody can be used in various applications such as immunohistochemistry, western blotting, and flow cytometry. It recognizes the antigen with high affinity and specificity, making it an essential tool for researchers in the Life Sciences field.