Primary Antibodies

GJA5 antibody was raised using the N terminal of GJA5 corresponding to a region with amino acids STPSLVYMGHAMHTVRMQEKRKLREAERAKEVRGSGSYEYPVAEKAELSC

MOR1 antibody was raised in rabbit using residues 386-400 NHQLENLEAETAPLP of the human, mouse and rat MOR-1 protein as the immunogen.

MIG antibody was raised in rabbit using highly pure recombinant human MIG as the immunogen.

BTF3L1 antibody was raised in rabbit using the n terminal of BTF3L1 as the immunogen

CCDC28A antibody was raised in rabbit using the middle region of CCDC28A as the immunogen

Purified Polyclonal LI Cadherin antibody

NCF4 antibody was raised using the middle region of NCF4 corresponding to a region with amino acids TGIFPLSFVKILKDFPEEDDPTNWLRCYYYEDTISTIKSVAWEGGACPAF

LRRC59 antibody was raised using the N terminal of LRRC59 corresponding to a region with amino acids TKAGSKGGNLRDKLDGNELDLSLSDLNEVPVKELAALPKATILDLSCNKL

UBA6 antibody was raised in rabbit using the middle region of UBA6 as the immunogen

IL1 beta antibody was raised in rabbit using highly pure recombinant murine IL-1-beta as the immunogen.

IL31 antibody was raised in rabbit using highly pure recombinant human IL-31 as the immunogen.

P2RX2 antibody was raised using the N terminal of P2RX2 corresponding to a region with amino acids VVRNRRLGVLYRAVQLLILLYFVWYVFIVQKSYQESETGPESSIITKVKG

SCYE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GTKEQIKGGTGDEKKAKEKIEKKGEKKEKKQQSIAGSADSKPIDVSRLDL

Purified Polyclonal Cadherin 8 antibody

ARF6 antibody was raised using the middle region of ARF6 corresponding to a region with amino acids REMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSG

ANKRD39 antibody was raised in rabbit using the N terminal of ANKRD39 as the immunogen

SLC35F1 antibody was raised using the N terminal of SLC35F1 corresponding to a region with amino acids MIPPEQPQQQLQPPSPAPPNHVVTTIENLPAEGSGGGGSLSASSRAGVRQ

GABARAP antibody was raised in rabbit using Residues 15-31 [RSEGEKIRKKYPDRVPV] of the GABARAP protein as the immunogen.

MAPK7 antibody was raised in rabbit using the middle region of MAPK7 as the immunogen

ATG4C antibody was raised in rabbit using the middle region of ATG4C as the immunogen

UCHL1 antibody was raised in rabbit using the C terminal of UCHL1 as the immunogen

Fgf1 antibody was raised in rabbit using the N terminal of Fgf1 as the immunogen

COPA antibody was raised using the N terminal of COPA corresponding to a region with amino acids PWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFHKQQPLFVSGGD

ZNF641 antibody was raised in rabbit using the middle region of ZNF641 as the immunogen

ApoA I antibody was raised against Human Apolipoprotein A1.

MUC3B antibody was raised using the N terminal of MUC3B corresponding to a region with amino acids MLCADVVETEVGMEVSVDQQFSPDLNDNTSQAYRDFNKTFWNQMQKIFAD

CRLS1 antibody was raised in rabbit using the middle region of CRLS1 as the immunogen

LIX antibody was raised in rabbit using highly pure recombinant murine LIX as the immunogen.

ZNF512 antibody was raised in rabbit using the middle region of ZNF512 as the immunogen

Synapsin 1 antibody is a highly specialized Polyclonal Antibody that plays a crucial role in endothelial growth and development. This antibody is widely used in the field of Life Sciences to study various cellular processes and identify specific cell antigens. The high viscosity of this antibody ensures efficient binding to target molecules, providing accurate and reliable results.

KCNK15 antibody was raised using the middle region of KCNK15 corresponding to a region with amino acids ARSVGSASVFCHVHKLERCARDNLGFSPPSSPGVVRGGQAPRPGARWKSI

MCM6 antibody was raised using the C terminal of MCM6 corresponding to a region with amino acids RIIEKVIHRLTHYDHVLIELTQAGLKGSTEGSESYEEDPYLVVNPNYLLE

ZNF608 antibody was raised in rabbit using the middle region of ZNF608 as the immunogen

ARR3 antibody was raised in rabbit using the middle region of ARR3 as the immunogen

XAGE2 antibody was raised in rabbit using the middle region of XAGE2 as the immunogen

TRAF3IP2 antibody was raised in rabbit using the N terminal of TRAF3IP2 as the immunogen

DNASE1 antibody was raised using the N terminal of DNASE1 corresponding to a region with amino acids GKLLDNLNQDAPDTYHYVVSEPLGRNSYKERYLFVYRPDQVSAVDSYYYD

ZNF580 antibody was raised in rabbit using the N terminal of ZNF580 as the immunogen

IGSF1 antibody was raised using the N terminal of IGSF1 corresponding to a region with amino acids WLLARPSAVVQMGQNVSLRCRGPVDGVGLALYKKGEDKPLQFLDATSIDD

RANTES antibody was raised in rabbit using highly pure recombinant human RANTES as the immunogen.

ARL5A antibody was raised using the middle region of ARL5A corresponding to a region with amino acids YKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQFLKLTSIKDHQWHIQA

USP20 antibody was raised in rabbit using the middle region of USP20 as the immunogen

ZIC1 antibody was raised in rabbit using the N terminal of ZIC1 as the immunogen

DHODH antibody was raised using the middle region of DHODH corresponding to a region with amino acids NLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAEL

GNAI3 antibody was raised in rabbit using the N terminal of GNAI3 as the immunogen

Oncostatin M antibody was raised in rabbit using highly pure recombinant human oncostatin M as the immunogen.

LOC727817 antibody was raised in rabbit using the N terminal of LOC727817 as the immunogen

ADRA1D antibody was raised in rabbit using the C terminal of ADRA1D as the immunogen

FTH1 antibody was raised using the middle region of FTH1 corresponding to a region with amino acids NVNQSLLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKM

Laminin Gamma 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KTREAQQALGSAAADATEAKNKAHEAERIASAVQKNATSTKAEAERTFAE

USP39 antibody was raised in rabbit using the N terminal of USP39 as the immunogen

BASP1 antibody was raised in rabbit using the C terminal of BASP1 as the immunogen

ABCB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids AIVPIIAIAGVVEMKMLSGQALKDKKELEGSGKIATEAIENFRTVVSLTQ

Sdhb antibody was raised in rabbit using the middle region of Sdhb as the immunogen

ENTPD7 antibody was raised using the C terminal of ENTPD7 corresponding to a region with amino acids EHRLKYQCFKSAWMYQVLHEGFHFPYDYPNLRTAQLVYDREVQWTLGAIL

Irx6 antibody was raised in rabbit using the middle region of Irx6 as the immunogen

RASSF8 antibody was raised in rabbit using the N terminal of RASSF8 as the immunogen

CSGALNACT1 antibody was raised using the N terminal Of Csgalnact1 corresponding to a region with amino acids KAEVNAGVKLATEYAAVPFDSFTLQKVYQLETGLTRHPEEKPVRKDKRDE

Myosin 7 antibody was raised in rabbit using the middle region of Myosin 7 as the immunogen

Purified Polyclonal IGF1 Receptor antibody

Purified Polyclonal ACOT2 antibody

Akt, also known as Protein Kinase B (PKB), is a serine/threonine-specific protein kinase that plays a vital role in cellular processes such as growth, survival, metabolism, and proliferation. As a central player in the PI3K/Akt/mTOR pathway, it integrates signals essential for cellular adaptation and function. Humans have three main Akt isoforms—Akt1, Akt2, and Akt3—each encoded by separate genes. Akt activation begins when external signals, such as growth factors or insulin, bind to cell surface receptors, activating phosphoinositide 3-kinase (PI3K). This leads to the production of PIP3 on the cell membrane, recruiting Akt and initiating two crucial phosphorylation steps at Thr308 and Ser473, after which Akt becomes fully activated and moves within the cell to phosphorylate its target proteins.Akt’s core functions include promoting cell survival by inhibiting apoptosis through phosphorylation of pro-apoptotic proteins like BAD and Caspase-9, and supporting cell growth and proliferation by activating mTOR, a key regulator of protein synthesis. It also plays a significant role in metabolic regulation, increasing glucose uptake and glycolysis through GLUT4 translocation and hexokinase activation, particularly in muscle and fat tissues. Additionally, Akt promotes angiogenesis by enhancing VEGF expression, which aids tissue repair, and supports cell migration, aiding wound healing but also facilitating cancer cell spread. Due to its extensive role in cell survival and growth, Akt is often hyperactivated in cancers, driving unchecked cell division and tumor progression, making it a target for cancer therapies. Its influence on glucose metabolism also connects Akt to insulin signaling, where pathway defects can impair glucose uptake, contributing to insulin resistance and type 2 diabetes.

IL15 antibody was raised in rabbit using E.coli-expressed murine IL-15 as the immunogen.

CENPB antibody was raised using the C terminal of CENPB corresponding to a region with amino acids GGEDSDSDSEEEDDEEEDDEDEDDDDDEEDGDEVPVPSFGEAMAYFAMVK

The Ubiquitin antibody is a cytotoxic monoclonal antibody that has neutralizing properties against ferritin, chemokines, and interferons. It is a glycoprotein that specifically targets ubiquitin, a protein involved in various cellular processes such as protein degradation and DNA repair. This antibody can be used in Life Sciences research to study the role of ubiquitin in different biological pathways. The Ubiquitin antibody has been tested for its efficacy in inhibiting hemolysis and has shown promising results. It does not contain any excipients or liver microsomes, making it safe for use in laboratory experiments.

CBLL1 antibody was raised in rabbit using the N terminal of CBLL1 as the immunogen

Zkscan1 antibody was raised in rabbit using the C terminal of Zkscan1 as the immunogen

OSBPL8 antibody was raised using the middle region of OSBPL8 corresponding to a region with amino acids YSSPEPDIQDSSGSEAQSVKPSTRRKKGIELGDIQSSIESIKQTQEEIKR

The Connexin 43 antibody is a highly specific and potent monoclonal antibody that targets the antigen Connexin 43. This antibody has been extensively tested and proven to effectively bind to Connexin 43 in various assays, making it an essential tool for researchers studying cellular communication and related processes.

PCDHB13 antibody was raised using the middle region of PCDHB13 corresponding to a region with amino acids GKTFKINPLTGEIELKKQLDFEKLQSYEVNIEARDAGTFSGKCTVLIQVI

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections. This active compound exhibits bactericidal activity by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, thereby preventing transcription and replication. Extensive research has shown its high frequency of human activity using a patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Furthermore, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.

Rabbit polyclonal Ferritin antibody (Prediluted for IHC)

ABHD12 antibody was raised using the middle region of ABHD12 corresponding to a region with amino acids CPLLILHAEDDPVVPFQLGRKLYSIAAPARSFRDFKVQFVPFHSDLGYRH

HOXA5 antibody was raised in rabbit using the C terminal of HOXA5 as the immunogen

UBQLN2 antibody was raised in rabbit using the N terminal of UBQLN2 as the immunogen

PIGK antibody was raised using the N terminal of PIGK corresponding to a region with amino acids SVYRSVKRLGIPDSHIVLMLADDMACNPRNPKPATVFSHKNMELNVYGDD

ABCD3 antibody was raised using a synthetic peptide corresponding to a region with amino acids LKYGLNELKLCFRVRLTKYLYEEYLQAFTYYKMGNLDNRIANPDQLLTQD

PEA15 antibody was raised using the middle region of PEA15 corresponding to a region with amino acids DLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKL

Ran antibody was raised using the middle region of RAN corresponding to a region with amino acids NLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPA

Fam168a antibody was raised in rabbit using the N terminal of Fam168a as the immunogen

RNF182 antibody was raised using the N terminal of RNF182 corresponding to a region with amino acids CLPDDEVSSLPDDNNILVNLTCGGKGKKCLPENPTELLLTPKRLASLVSP

TNFSF13B antibody was raised using a synthetic peptide corresponding to a region with amino acids ALQGDLASLRAELQGHHAEKLPAGAGAPKAGLEEAPAVTAGLKIFEPPAP

SLC1A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids  LVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQHRVHEDIEM

ENTPD8 antibody was raised using the N terminal of ENTPD8 corresponding to a region with amino acids IPEAQHRKTPTFLGATAGMRLLSRKNSSQARDIFAAVTQVLGRSPVDFWG

BRDT antibody was raised in rabbit using the N terminal of BRDT as the immunogen

Twist1 antibody was raised in rabbit using the N terminal of Twist1 as the immunogen