Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
CD3e antibody (CY5)
CD3e antibody (CY5) was raised in rat using CD3e as the immunogen.
Purity:Min. 95%CD8b antibody (FITC)
CD8b antibody (FITC) was raised in Mouse using the beta chain of chicken CD8 as the immunogen.Purity:Min. 95%CD23 antibody (PE-CY7)
CD23 antibody (PE) was raised in rat using CD23 low affinity IgE Fc receptor as the immunogen.Purity:Min. 95%CD105 antibody (FITC)
CD105 antibody (FITC) was raised in mouse using membrane preparation of human B-lineage leukemia cells as the immunogen.Purity:Min. 95%Streptococcus Group A antibody (HRP)
Streptococcus group A antibody (FITC) was raised in goat using group A Streptococci as the immunogen.Purity:Min. 95%CD66acde antibody
CD66acde antibody was raised in mouse using human granulocytes as the immunogen.Purity:Min. 95%CD154 antibody (PE)
CD154 antibody (PE) was raised in hamster using activated murine Th1 clone D1.6 as the immunogen.Purity:Min. 95%CD106 antibody (Azide Free)
CD106 antibody (Azide free) was raised in rat using murine CD106/VCAM-1 as the immunogen.
Purity:Min. 95%CD45 antibody (FITC)
CD45 antibody (FITC) was raised in mouse using chicken CD45 as the immunogen.Purity:Min. 95%CD117 antibody (Spectral Red)
CD117 antibody (FITC) was raised in rat using murine CD117/c-Kit as the immunogen.Purity:Min. 95%CD18 antibody (biotin)
CD18 antibody (biotin) was raised in rat using cell membrane lysates derived from murine T cell lymphoma BW5147 as the immunogen.
Purity:Min. 95%CD8a antibody (biotin)
CD8a antibody (biotin) was raised in mouse using the alpha chain of chicken CD8a as the immunogen.Purity:Min. 95%CD25 antibody (PE-CY7)
CD25 antibody (PE-CY7) was raised in rat using IL-2-dependent BALB/c mouse helper T-cell clone HT-2 as the immunogen.Purity:Min. 95%CD72.1 antibody (PE)
CD72.1 antibody (PE) was raised in mouse using DBA/2 murine spleen cells as the immunogen.Purity:Min. 95%CD4 antibody (PE-CY7)
CD4 antibody (PE-CY7) was raised in rat using cloned murine CTL line V4 as the immunogen.
Purity:Min. 95%CD49b antibody (Allophycocyanin-CY7)
CD49b antibody (Allophycocyanin-CY7) was raised in rat using RIL-2-propagated NK1.1+ cells from C57BL/6 mice as the immunogen.
Purity:Min. 95%CD45R antibody (Azide Free)
CD45R antibody (Azide Free) was raised in rat using abelson murine leukemia virus-induced pre-B tumor cells as the immunogen.Purity:Min. 95%CD102 antibody (PE)
CD102 antibody (biotin) was raised in rat using COS cells transfected with mouse ICAM-2 cDNA as the immunogen.Purity:Min. 95%CD19 antibody (PE-CY7)
CD19 antibody (PE) was raised in mouse using human CD19 as the immunogen.Purity:Min. 95%CD62E antibody (PE)
CD62E antibody was raised in mouse using human CD62E/E-selectin as the immunogen.Purity:Min. 95%Goat anti Rabbit IgG (H + L) (Poly-HRP40)
Goat anti-rabbit IgG (H+L) (Poly-HRP40) was raised in goat using rabbit IgG as the immunogen.Purity:Min. 95%CD147 antibody (PE)
CD147 antibody (PE) was raised in mouse using human T cell line Molt 13 as the immunogen.Purity:Min. 95%Streptococcus Group A antibody
Streptococcus group A antibody was raised in rabbit using group A Streptococci as the immunogen.Purity:Min. 95%CD44 antibody (biotin)
CD44 antibody (biotin) was raised in mouse using human CD44 as the immunogenPurity:Min. 95%CD45R antibody (Spectral Red)
CD45R antibody (PE-CY7) was raised in rat using abelson murine leukemia virus-induced pre-B tumor cells as the immunogen.Purity:Min. 95%CD8a antibody (PE-Texas Red)
CD8a antibody (FITC) was raised in rat using mouse thymus or spleen as the immunogen.
Purity:Min. 95%CD11b antibody (Spectral Red)
CD11b antibody (PE) was raised in rat using C57BL/10 murine splenic T-cells and concanavalin A-activted C57BL/10 splenocytes as the immunogen.
Purity:Min. 95%CD3e antibody (FITC)
CD3e antibody (FITC) was raised in mouse using porcine CD3e as the immunogen.
Purity:Min. 95%CD24 antibody (Spectral Red)
CD24 antibody (Spectral Red) was raised in rat using murine heat stable antigen as the immunogen.
Purity:Min. 95%CD3 antibody (Allophycocyanin-CY7)
CD3 antibody (Allophycocyanin-CY7) was raised in mouse using the epsilon chain of CD3/T-cell antigen receptor complex as the immunogen.Purity:Min. 95%CD19 antibody (biotin)
CD19 antibody (biotin) was raised in rat using murine CD19-expressing K562 human erythroleukemia cells as the immunogen.Purity:Min. 95%CD166 antibody (FITC)
CD166 antibody (FITC) was raised in mouse using human thymic epithelial cells as the immunogen.Purity:Min. 95%CD106 antibody (PE)
CD106 antibody (PE) was raised in rat using murine CD106/VCAM-1 as the immunogen.Purity:Min. 95%CD3 antibody (CY5)
CD3 antibody (CY5) was raised in mouse using the epsilon chain of CD3/T-cell antigen receptor complex as the immunogen.Purity:Min. 95%CD62L antibody (PE-CY7)
CD62L antibody (PE-CY7) was raised in rat using C3H/eb cloned murine B lymphoma 38C-13 as the immunogen.
Purity:Min. 95%CD19 antibody (CY5)
CD19 antibody (CY5) was raised in mouse using human CD19 as the immunogen.Purity:Min. 95%CD94 antibody (PE)
CD94 antibody (PE) was raised in rat using CHO cells transfected with the B6 allele of CD94 as the immunogen.
Purity:Min. 95%CD49b antibody (biotin)
CD49b antibody (biotin) was raised in rat using RIL-2-propagated NK1.1+ cells from C57BL/6 mice as the immunogen.Purity:Min. 95%CD8a antibody (biotin)
CD8a antibody (biotin) was raised in Mouse using the alpha chainc of chicken CD8 as the immunogen.
Purity:Min. 95%CD38 antibody (biotin)
CD38 antibody (biotin) was raised in rat using CD38 as the immunogen.Purity:Min. 95%CD25 antibody (Allophycocyanin)
CD25 antibody (Allophycocyanin) was raised in rat using IL-2-dependent BALB/c mouse helper T-cell clone HT-2 as the immunogen.Purity:Min. 95%CD8a antibody (biotin)
CD8a antibody (biotin) was raised in mouse using trhe alpha chain of chicken CD8 as the immunogen.
Purity:Min. 95%Complement C3c antibody
Complement C3c antibody is a highly specialized antibody that specifically targets the C3c component of the complement system. This antibody is designed to detect and bind to C3c, which plays a crucial role in immune response and inflammation. The antibody is conjugated with a fluorescent probe, allowing for easy visualization and detection of C3c in various biological samples.Purity:Min. 95%CD26 antibody (biotin)
CD26 antibody (biotin) was raised in mouse using human ocular melanoma cell line V+B2 as the immunogen.Purity:Min. 95%CD235a antibody (FITC)
CD235a antibody (FITC) was raised in mouse using human erythrocytes as the immunogen.
Purity:Min. 95%CD146 antibody (biotin)
CD146 antibody (biotin) was raised in mouse using CD146 immunopurified molecule as the immunogen.Purity:Min. 95%CD103 antibody (PE)
CD103 antibody (FITC) was raised in hamster using murine CD103 as the immunogen.Purity:Min. 95%CD24 antibody (FITC)
CD24 antibody (FITC) was raised in rat using murine heat stable antigen as the immunogen.Purity:Min. 95%CD40 antibody (Allophycocyanin)
CD40 antibody (Allophycocyanin) was raised in rat using CD40 as the immunogen
Purity:Min. 95%CD62L antibody (PE-CY7)
CD62L antibody (PE) was raised in rat using C3H/eb cloned murine B lymphoma 38C-13 as the immunogen.
Purity:Min. 95%CD154 antibody (FITC)
CD154 antibody (FITC) was raised in mouse using human sgp39 fusion protein as the immunogen.
Purity:Min. 95%CD11b antibody (Spectral Red)
CD11b antibody (CY5) was raised in rat using C57BL/10 murine splenic T-cells and concanavalin A-activted C57BL/10 splenocytes as the immunogen.
Purity:Min. 95%CD72.1 antibody (biotin)
CD72.1 antibody (biotin) was raised in mouse using DBA/2 murine spleen cells as the immunogen.
Purity:Min. 95%CD16 antibody (PE)
CD16 antibody (PE) was raised in mouse using human polymorphonuclear leukocytes as the immunogen.Purity:Min. 95%CD4a antibody (Spectral Red)
CD4a antibody (Spectral Red)) was raised in mouse using CD4a as the immunogen.
Purity:Min. 95%CD8a antibody (CY5)
CD8a antibody (CY5) was raised in Mouse using the alpha chainc of chicken CD8 as the immunogen.Purity:Min. 95%CD69 antibody (Spectral Red)
CD69 antibody (Spectral Red) was raised in hamster using Y245 murine dendritic epidermal T cell line as the immunogen.Purity:Min. 95%CD18 antibody (PE)
CD18 antibody (PE) was raised in rat using cell membrane lysates derived from murine T cell lymphoma BW5147 as the immunogen.Purity:Min. 95%CD3e antibody (biotin)
CD3e antibody (biotin) was raised in mouse using porcine CD3e as the immunogen.
Purity:Min. 95%CD28 antibody (Spectral Red)
CD28 antibody (Spectral Red) was raised in hamster using CD28 costimulatory receptor as the immunogen.Purity:Min. 95%CD25 antibody (Spectral Red)
CD25 antibody (Spectral Red) was raised in rat using alpha chain IL-2 receptor as the immunogen.Purity:Min. 95%CD19 antibody (biotin)
CD19 antibody (biotin) was raised in mouse using human CD19 as the immunogen.Purity:Min. 95%CD106 antibody (PE)
CD106 antibody (biotin) was raised in Mouse using human CD106/VCAM-1 as the immunogen.
Purity:Min. 95%CD106 antibody (PE)
CD106 antibody (biotin) was raised in rat using murine CD106/VCAM-1 as the immunogen.Purity:Min. 95%CD56 antibody (PE-CY5.5)
CD56 antibody (PE CY5.5) was raised in mouse using human CD56 as the immunogen.Purity:Min. 95%CD122 antibody (FITC)
CD122 antibody (Allophycocyanin) was raised in rat using rat myeloma YB2/0 transfected with truncated murine IL-2RB cDNA as the immunogen.Purity:Min. 95%CD90 antibody (PE)
CD90 antibody (PE) was raised in mouse using Thy-1 molecule as the immunogen.Purity:Min. 95%CD19 antibody (PE-CY7)
CD19 antibody (PE-CY5.5) was raised in mouse using human CD19 as the immunogen.Purity:Min. 95%CD107b antibody
CD107b antibody was raised in rat using glycoproteins purified from BALB/c mouse embryo 3T3 cell line as the immunogen.Purity:Min. 95%CD117 antibody (PE)
CD117 antibody (PE) was raised in mouse using human MO7e tumor cells as the immunogen.
Purity:Min. 95%CD3e antibody (Allophycocyanin)
CD3e antibody (Allophycocyanin) was raised in hamster using T cell receptor complexes derived from C6VL-BS thymoma cells as the immunogen.Purity:Min. 95%CD80 antibody (PE)
CD80 antibody (PE) was raised in rat using CD80/B7-1 as the immunogen.Purity:Min. 95%CD44 antibody (Allophycocyanin)
CD44 antibody (Allophycocyanin) was raised in mouse using chicken CD44 as the immunogen.Purity:Min. 95%CD20 antibody (Allophycocyanin-CY7)
CD20 antibody (Allophycocyanin) was raised in mouse using human CD20 as the immunogen.
Purity:Min. 95%CD79b antibody (PE)
CD79b antibody (biotin) was raised in hamster using the beta chain of the murine B-cell receptor as the immunogen.
Purity:Min. 95%Parainfluenza type 3 antibody (FITC)
Parainfluenza type 3 antibody (FITC) was raised in mouse using hemagluttinin of parainfluenza virus, type 3 as the immunogen.CD5 antibody (Allophycocyanin)
CD5 antibody (Allophycocyanin) was raised in rat using CD5/Lyt-1 as the immunogen.Purity:Min. 95%CD44 antibody (FITC)
CD44 antibody (FITC) was raised in mouse using chicken CD44 as the immunogen.Purity:Min. 95%CD90.2 antibody (biotin)
CD90.2 antibody (biotin) was raised in rat using CD90.2/`Thy-1.2 alloantigen as the immunogen.
Purity:Min. 95%CD11a antibody (PE)
CD11a antibody (PE) was raised in mouse using human CD11a (LFA-1a) as the immunogen.Purity:Min. 95%CD45.1 antibody (PE)
CD45.1 antibody (PE-CY5.5) was raised in mouse using CD45.1 as the immunogen.Purity:Min. 95%CD4 antibody (Allophycocyanin-CY5.5)
CD4 antibody (Allophycocyanin-CY5.5) was raised in rat using cloned mueine CTL line V4 as the immunogen.Purity:Min. 95%CD28 antibody (FITC)
CD28 antibody (FITC) was raised in hamster using CD28 costimulatory receptor as the immunogen.Purity:Min. 95%CD106 antibody
CD106 antibody was raised in Mouse using human CD106/VCAM-1 as the immunogen.Purity:Min. 95%CD4 antibody (Allophycocyanin-CY7)
CD4 antibody (Allophycocyanin-CY7) was raised in mouse using human CD4 as the immunoge.Purity:Min. 95%CD45.1 antibody (PE)
CD45.1 antibody (PE) was raised in mouse using CD45.1 as the immunogen.Purity:Min. 95%CD56 antibody (biotin)
CD56 antibody (biotin) was raised in mouse using human CD56 as the immunogen.
Purity:Min. 95%CD31 antibody (biotin)
CD31 antibody (biotin) was raised in rat using murine leukocyte cell line 32D as the immunogen.Purity:Min. 95%CD45R antibody (Spectral Red)
CD45R antibody (PE) was raised in rat using abelson murine leukemia virus-induced pre-B tumor cells as the immunogen.Purity:Min. 95%CD45R antibody (Spectral Red)
CD45R antibody (FITC) was raised in rat using abelson murine leukemia virus-induced pre-B tumor cells as the immunogen.Purity:Min. 95%CD45RB antibody (Spectral Red)
CD45RB antibody (Spectral Red) was raised in rat using cloned murine Th2 cell lines as the immunogen.Purity:Min. 95%CD45R antibody (Spectral Red)
CD45R antibody (PE-CY5.5) was raised in rat using abelson murine leukemia virus-induced pre-B tumor cells as the immunogen.Purity:Min. 95%CD5 antibody (Allophycocyanin)
CD5 antibody (Allophycocyanin) was raised in mouse using human CD5 as the immunogen.Purity:Min. 95%CD44 antibody (PE)
CD44 antibody (PE) was raised in mouse using chicken CD44 as the immunogen.Purity:Min. 95%ApoE antibody
The ApoE antibody is a powerful tool in the field of Life Sciences. It is a polyclonal antibody that specifically targets ApoE, a cell antigen involved in lipid metabolism. This antibody can be used for various applications, including studying the role of ApoE in hepatic lipase activity, interleukin-6 production, and lipoprotein lipase function. Additionally, monoclonal antibodies against ApoE have been developed for research purposes. These antibodies have shown potential in detecting amyloid plaques associated with neurodegenerative diseases like Alzheimer's. With its high specificity and sensitivity, the ApoE antibody is an invaluable asset for researchers working on multidrug studies, viscosity analysis, and phosphatase assays.Purity:Min. 95%GIMAP6 antibody
GIMAP6 antibody was raised in rabbit using the C terminal of GIMAP6 as the immunogenPurity:Min. 95%TNFRSF21 antibody
TNFRSF21 antibody was raised using the N terminal of TNFRSF21 corresponding to a region with amino acids TTTAQPEQKASNLIGTYRHVDRATGQVLTCDKCPAGTYVSEHCTNTSLRVPurity:Min. 95%
