Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75447 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
KLRG1 antibody (Azide Free)
KLRG1 antibody (Azide free) was raised in hamster using activated NK (A-LAK) cells from B6 mice as the immunogen.Purity:Min. 95%CD38 antibody (FITC)
CD38 antibody (FITC) was raised in rat using CD38 as the immunogen.Purity:Min. 95%CD49b antibody (FITC)
CD49b antibody (FITC) was raised in rat using RIL-2-propagated NK1.1+ cells from C57BL/6 mice as the immunogen.Purity:Min. 95%CD11c antibody (FITC)
CD11c antibody (biotin) was raised in mouse using human rheumatoid synovial fluid cells/monocytes as the immunogen.
Purity:Min. 95%CD107a antibody (FITC)
CD107a antibody (Allophycocyanin) was raised in rat using murine CD107a (LAMP-1) as the immunogen.Purity:Min. 95%CD11b antibody (Spectral Red)
CD11b antibody (Allophycocyanin) was raised in rat using C57BL/10 murine splenic T cells and concanavalin A-activated C57BL/10 splenocytes as the immunogen.Purity:Min. 95%ApoC-I antibody
ApoC-I antibody was raised in goat using full-length recombinant apolipoprotein type C-I produced as the immunogen.Purity:Min. 95%CD11a antibody (Azide Free)
CD11a antibody (Azide Free) was raised in rat using murine CD11a (LFA-1a) as the immunogen.
Purity:Min. 95%CD8a antibody (Spectral Red)
CD8a antibody (Spectral Red) was raised in rat using murine thymus or spleen as the immunogen.
Purity:Min. 95%RASGEF1C antibody
RASGEF1C antibody was raised using the middle region of RASGEF1C corresponding to a region with amino acids FLELAKQVGEFITWKQVECPFEQDASITHYLYTAPIFSEDGLYLASYESE
Purity:Min. 95%SERINC2 antibody
SERINC2 antibody was raised in rabbit using the middle region of SERINC2 as the immunogenPurity:Min. 95%ABRA antibody
ABRA antibody was raised in rabbit using the middle region of ABRA as the immunogen
Purity:Min. 95%CDH12 antibody
CDH12 antibody was raised using a synthetic peptide corresponding to a region with amino acids DTQEGVIKLKKPLDFETKKAYTFKVEASNLHLDHRFHSAGPFKDTATVKI
Purity:Min. 95%TNF beta antibody
TNF beta antibody was raised in rabbit using highly pure recombinant human TNF-beta as the immunogen.Purity:Min. 95%MCART6 antibody
MCART6 antibody was raised using the middle region of MCART6 corresponding to a region with amino acids WPVLARNSLGSALYFSFKDPIQDGLAEQGLPHWVPALVSGSVNGTITCLVPurity:Min. 95%ZNF169 antibody
ZNF169 antibody was raised in rabbit using the middle region of ZNF169 as the immunogenPurity:Min. 95%Eotaxin 2 antibody
Eotaxin 2 antibody was raised in goat using highly pure recombinant murine eotaxin-2 as the immunogen.
Purity:Min. 95%GRIK5 antibody
GRIK5 antibody was raised using the middle region of GRIK5 corresponding to a region with amino acids EDGLYGAPEPNGSWTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFMPurity:Min. 95%LYCAT antibody
LYCAT antibody was raised using the middle region of LYCAT corresponding to a region with amino acids YLYSLVKWYFIITIVIFVLQERIFGGLEIIELACYRLLHKQPHLNSKKNEPurity:Min. 95%SLC7A4 antibody
SLC7A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids GAYILVSTVLTLMVPWHSLDPDSALADAFYQRGYRWAGFIVAAGSICAMNPurity:Min. 95%SLC22A11 antibody
SLC22A11 antibody was raised using a synthetic peptide corresponding to a region with amino acids ASSLVVLFFLPETQGLPLPDTIQDLESQKSTAAQGNRQEAVTVESTSLPurity:Min. 95%Cytokeratin 8 antibody
The Cytokeratin 8 antibody is a recombinant monoclonal antibody that serves as a diagnostic reagent for various applications. It is specifically designed to target cytokeratin 8, a protein found in liver microsomes and human serum. This antibody can be used in immunohistochemistry, Western blotting, and other techniques for the detection and analysis of cytokeratin 8 expression.Purity:Min. 95%PINK1 antibody
PINK1 antibody was raised in rabbit using residues 258-274 (YRKSKRGPKQLAPHPNI) of human PINK1 as the immunogen.Purity:Min. 95%IL22 antibody
IL22 antibody was raised using the C terminal of IL22 corresponding to a region with amino acids CHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACIPurity:Min. 95%CAV1 antibody
CAV1 antibody was raised in rabbit using a synthetic peptide corresponding to residues M(1) S G G K Y V D S E G H L Y T V P(17) C of human CAV1 as the immunogen.Purity:Min. 95%NOTCH1 antibody
NOTCH1 antibody was raised in rabbit using the middle region of NOTCH1 as the immunogenPurity:Min. 95%TRIM23 antibody
TRIM23 antibody was raised in rabbit using the N terminal of TRIM23 as the immunogen
Purity:Min. 95%SMARCA2 antibody
SMARCA2 antibody was raised in rabbit using the middle region of SMARCA2 as the immunogenBCAT1 antibody
BCAT1 antibody was raised using the N terminal of BCAT1 corresponding to a region with amino acids MKDCSNGCSAECTGEGGSKEVVGTFKAKDLIVTPATILKEKPDPNNLVFG
Purity:Min. 95%DGAT2L7 antibody
DGAT2L7 antibody was raised in rabbit using the C terminal of DGAT2L7 as the immunogenPurity:Min. 95%FGF4 antibody
FGF4 antibody was raised in rabbit using highly pure recombinant human FGF-4 as the immunogen.
Purity:Min. 95%SLC25A46 antibody
SLC25A46 antibody was raised using the C terminal of SLC25A46 corresponding to a region with amino acids LKRKTYNSHLAESTSPVQSMLDAYFPELIANFAASLCSDVILYPLETVLH
Purity:Min. 95%CNTNAP4 antibody
CNTNAP4 antibody was raised using the N terminal of CNTNAP4 corresponding to a region with amino acids KLPSTSTLVNLTLGSLLDDQHWHSVLIQRLGKQVNFTVDEHRHHFHARGEPurity:Min. 95%GCH1 antibody
GCH1 antibody was raised in rabbit using the C terminal of GCH1 as the immunogenPurity:Min. 95%ABCC3 antibody
ABCC3 antibody was raised using a synthetic peptide corresponding to a region with amino acids KVHMKGSVAYVPQQAWIQNCTLQENVLFGKALNPKRYQQTLEACALLADLPurity:Min. 95%GTSE1 antibody
GTSE1 antibody was raised using the middle region of GTSE1 corresponding to a region with amino acids IDLMTNTPDMNKNVAKPSPVVGQLIDLSSPLIQLSPEADKENVDSPLLKFPurity:Min. 95%RELM beta antibody
RELM beta antibody was raised in rabbit using residues 32-46 [DQRIKEALSRQEPKT] of the mouse RELM-Beta protein as the immunogen.Purity:Min. 95%OTUD6B antibody
OTUD6B antibody was raised using the middle region of OTUD6B corresponding to a region with amino acids EIIQADSPPIIVGEEYSKKPLILVYMRHAYGLGEHYNSVTRLVNIVTENCPurity:Min. 95%ZFP91 antibody
ZFP91 antibody was raised in rabbit using the N terminal of ZFP91 as the immunogenPurity:Min. 95%WNT7B antibody
WNT7B antibody was raised using the middle region of WNT7B corresponding to a region with amino acids WTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPMPurity:Min. 95%AAV4 antibody
AAV4 antibody was raised in rabbit using residues 456-467 [NFTKLRPTNFSNC] of 81 kDa capsid VP3 protein of AAV 4 as the immunogen.Purity:Min. 95%Insr antibody
Insr antibody was raised in rabbit using the middle region of Insr as the immunogenPurity:Min. 95%Scel antibody
Scel antibody was raised in rabbit using the C terminal of Scel as the immunogenPurity:Min. 95%BEST3 antibody
BEST3 antibody was raised in rabbit using the C terminal of BEST3 as the immunogenPurity:Min. 95%UST antibody
UST antibody was raised using the N terminal of UST corresponding to a region with amino acids PPRFLLDLRQYLGNSTYLDDHGPPPSKVLPFPSQVVYNRVGKCGSRTVVLPurity:Min. 95%IL3 beta antibody
IL3 beta antibody was raised in goat using highly pure recombinant rat IL-3beta as the immunogen.Purity:Min. 95%LYPD4 antibody
LYPD4 antibody was raised using the N terminal of LYPD4 corresponding to a region with amino acids MGPQHLRLVQLFCLLGAISTLPRAGALLCYEATASRFRAVAFHNWKWLLM
Purity:Min. 95%Csnk1g1 antibody
Csnk1g1 antibody was raised in rabbit using the middle region of CSNK1G1 as the immunogen
Purity:Min. 95%Factor XIII B Polypeptide antibody
Factor XIII B Polypeptide antibody was raised using the middle region of F13B corresponding to a region with amino acids LRLIENGYFHPVKQTYEEGDVVQFFCHENYYLSGSDLIQCYNFGWYPESP
Purity:Min. 95%STAT1 antibody
The STAT1 antibody is a powerful diagnostic reagent used in the field of life sciences. It is a monoclonal antibody that specifically targets and binds to STAT1, a protein involved in various cellular processes. This antibody can be used for immunocytochemical methods to detect the presence and localization of activated STAT1 in cells. It can also be utilized for receptor binding studies and as a tool in research related to TGF-beta signaling pathways. The STAT1 antibody is highly specific and provides reliable results, making it an essential tool for scientists and researchers working in the field of signal transduction and immunology. With its exceptional performance, this antibody is an invaluable asset for any laboratory or research facility.Purity:Min. 95%TMEM75 antibody
TMEM75 antibody was raised using the C terminal of TMEM75 corresponding to a region with amino acids VTISQDSETLSLDCDHRLFFSLPFTDPASGGQSQHSWPCPERSKNLPQVS
Purity:Min. 95%SNAG1 antibody
SNAG1 antibody was raised using the N terminal Of Snag1 corresponding to a region with amino acids LLQPQQAPPPSTFQPPGAGFPYGGGALQPSPQQLYGGYQASQGSDDDWDDPurity:Min. 95%USP1 antibody
USP1 antibody was raised in rabbit using the C terminal of USP1 as the immunogenPurity:Min. 95%ATG3 antibody
ATG3 antibody was raised in rabbit using the middle region of ATG3 as the immunogenPurity:Min. 95%ADAM33 antibody
ADAM33 antibody was raised using the middle region of ADAM33 corresponding to a region with amino acids HDSAQLLTGRAFQGATVGLAPVEGMCRAESSGGVSTDHSELPIGAAATMA
Purity:Min. 95%MORF4 antibody
MORF4 antibody was raised in rabbit using the middle region of MORF4 as the immunogenPurity:Min. 95%NPY1R antibody
NPY1R antibody was raised using the middle region of NPY1R corresponding to a region with amino acids TDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFIPurity:Min. 95%COX10 antibody
COX10 antibody was raised using the middle region of COX10 corresponding to a region with amino acids APGPFDWPCFLLTSVGTGLASCAANSINQFFEVPFDSNMNRTKNRPLVRGPurity:Min. 95%CDC2 antibody
CDC2 antibody was raised using the middle region of Cdc2 corresponding to a region with amino acids DYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHP
Purity:Min. 95%MOS antibody
MOS antibody was raised using the middle region of MOS corresponding to a region with amino acids LNVARLRHDNIVRVVAASTRTPAGSNSLGTIIMEFGGNVTLHQVIYGAAGPurity:Min. 95%TMEM63C antibody
TMEM63C antibody was raised using the middle region of TMEM63C corresponding to a region with amino acids EEEIQTVFDMEPSSTSSTPTSLLYVATVLQEPELNLTPASSPARHTYGTMPurity:Min. 95%PODXL2 antibody
PODXL2 antibody was raised in rabbit using the N terminal of PODXL2 as the immunogenPurity:Min. 95%Sideroflexin 1 antibody
Sideroflexin 1 antibody was raised using the N terminal of SFXN1 corresponding to a region with amino acids MSGELPPNINIKEPRWDQSTFIGRANHFFTVTDPRNILLTNEQLESARKI
Purity:Min. 95%ARF1 antibody
ARF1 antibody was raised in rabbit using the middle region of ARF1 as the immunogenPurity:Min. 95%CBFA2T2H antibody
CBFA2T2H antibody was raised in rabbit using the middle region of CBFA2T2H as the immunogenPurity:Min. 95%SLC24A4 antibody
SLC24A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids PSLEKICERLHLSEDVAGATFMAAGSSTPELFASVIGVFITHGDVGVGTIPurity:Min. 95%NR3C1 antibody
NR3C1 antibody was raised in rabbit using the N terminal of NR3C1 as the immunogenPurity:Min. 95%BCL2 antibody
The BCL2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and neutralize the BCL2 protein, which plays a crucial role in regulating cell survival and apoptosis. By binding to BCL2, this antibody effectively inhibits its function and prevents abnormal cell growth and proliferation.Purity:Min. 95%NEURL2 antibody
NEURL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAAASEPVDSGALWGLERPEPPPTRFHRVHGANIRVDPSGTRATRVESFA
Purity:Min. 95%AGK antibody
AGK antibody was raised in rabbit using the N terminal of AGK as the immunogenPurity:Min. 95%HAS3 antibody
HAS3 antibody was raised using the N terminal of HAS3 corresponding to a region with amino acids GQALKLPSPRRGSVALCIAAYQEDPDYLRKCLRSAQRISFPDLKVVMVVDPurity:Min. 95%Dcdc2a antibody
Dcdc2a antibody was raised in rabbit using the N terminal of Dcdc2a as the immunogenPurity:Min. 95%OR13C5 antibody
OR13C5 antibody was raised in rabbit using the N terminal of OR13C5 as the immunogenPurity:Min. 95%SDCBP antibody
SDCBP antibody was raised using a synthetic peptide corresponding to a region with amino acids NGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVPurity:Min. 95%STYK1 antibody
STYK1 antibody was raised using the C terminal of STYK1 corresponding to a region with amino acids PERLLLRPASIRADVWSFGILLYEMVTLGAPPYPEVPPTSILEHLQRRKIPurity:Min. 95%ARMCX3 antibody
ARMCX3 antibody was raised using the middle region of ARMCX3 corresponding to a region with amino acids LFSAGNEETKLQVLKLLLNLAENPAMTRELLRAQVPSSLGSLFNKKENKEPurity:Min. 95%CDC4 (69kDa) antibody
CDC4 (69kDa) antibody was raised in rabbit using N terminus of the 69 kDa isoform of the hCdc4 protein as the immunogen.Purity:Min. 95%PCDH12 antibody
PCDH12 antibody was raised using the middle region of PCDH12 corresponding to a region with amino acids SSRPFLLTTIVARDADSGANGEPLYSIRSGNEAHLFILNPHTGQLFVNVTPurity:Min. 95%Junctophilin 1 antibody
Junctophilin 1 antibody was raised using the C terminal of JPH1 corresponding to a region with amino acids SNGELHSQYHGYYVKLNAPQHPPVDVEDGDGSSQSSSALVHKPSANKWSPPurity:Min. 95%AADACL4 antibody
AADACL4 antibody was raised using the N terminal of AADACL4 corresponding to a region with amino acids FIRFLHDSVRIKKDPELVVTDLRFGTIPVRLFQPKAASSRPRRGIIFYHGPurity:Min. 95%PRELP antibody
PRELP antibody was raised using the middle region of PRELP corresponding to a region with amino acids SNKIETIPNGYFKSFPNLAFIRLNYNKLTDRGLPKNSFNISNLLVLHLSHPurity:Min. 95%DNASE2B antibody
DNASE2B antibody was raised using the middle region of DNASE2B corresponding to a region with amino acids IKAIKLSRHSYFSSYQDHAKWCISQKGTKNRWTCIGDLNRSPHQAFRSGG
Purity:Min. 95%SMYD1 antibody
SMYD1 antibody was raised in rabbit using the N terminal of SMYD1 as the immunogenPurity:Min. 95%AK3 antibody
AK3 antibody was raised using the N terminal of AK3 corresponding to a region with amino acids MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGT
Purity:Min. 95%NLK antibody
NLK antibody was raised in rabbit using the middle region of NLK as the immunogenPurity:Min. 95%DLG3 antibody
DLG3 antibody was raised using a synthetic peptide corresponding to a region with amino acids HEQAAAALKRAGQSVTIVAQYRPEEYSRFESKIHDLREQMMNSSMSSGSGPurity:Min. 95%SLC6A3 antibody
SLC6A3 antibody was raised in rabbit using the N terminal of SLC6A3 as the immunogenPurity:Min. 95%SLC26A10 antibody
SLC26A10 antibody was raised in rabbit using the N terminal of SLC26A10 as the immunogen
Purity:Min. 95%BCL10 antibody
BCL10 antibody was raised in rabbit using C terminal sequence [EMFLPLRSRTVSRQC] of Bcl10 as the immunogen.
Purity:Min. 95%MIP1 alpha antibody
MIP1 alpha antibody was raised in rabbit using highly pure recombinant rat MIP1 alpha as the immunogen.
Purity:Min. 95%FGFR1 antibody
The FGFR1 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and inhibits the growth factor receptor FGFR1, which plays a crucial role in cell growth and proliferation. By blocking the activation of FGFR1, this antibody prevents the downstream signaling pathways that promote cell division.
Purity:Min. 95%Dopamine D3 Receptor antibody
Dopamine D3 receptor antibody was raised in rabbit using a 19 amino acid peptide of human D3R as the immunogen.Purity:Min. 95%ALDH6A1 antibody
ALDH6A1 antibody was raised using the middle region of ALDH6A1 corresponding to a region with amino acids AVLVGEAKKWLPELVEHAKNLRVNAGDQPGADLGPLITPQAKERVCNLIDPurity:Min. 95%TMEFF1 antibody
TMEFF1 antibody was raised using the middle region of TMEFF1 corresponding to a region with amino acids YSDNGSGSGEGEEEGSGAEVHRKHSKCGPCKYKAECDEDAENVGCVCNIDPurity:Min. 95%SMC4 antibody
SMC4 antibody was raised using the N terminal of SMC4 corresponding to a region with amino acids SGRTESPATAAETASEELDNRSLEEILNSIPPPPPPAMTNEAGAPRLMITPurity:Min. 95%ZNF256 antibody
ZNF256 antibody was raised in rabbit using the N terminal of ZNF256 as the immunogenPurity:Min. 95%
