Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
Anti-BAX Polyclonal Antibody 3
Antibody Type: Rabbit Polyclonal
Application: WB
Reactivity: Mouse,Rat (predicted:Dog,Pig,Cow,Horse,Rabbit,Sheep)Color and Shape:LiquidMolecular weight:Theoretical: 21 kDa.Anti-CPT1A Polyclonal Antibody 2
Antibody Type: Rabbit Polyclonal
Application: WB
Reactivity: Mouse,Rat (predicted:Human,Chicken,Dog,Pig,Cow)Color and Shape:LiquidMolecular weight:Theoretical: 86 kDa.Anti-NAIP Antibody (1X15)
Antibody Type: Recombinant Rabbit Monoclonal
Application: WB
Reactivity: HumanMolecular weight:Theoretical: 160 kDa. Actual: 160 kDa.Anti-Phospho-PLCB3 (Ser537) Antibody (5F98)
Antibody Type: Recombinant Rabbit Monoclonal
Application: FCM,ICC/IF
Reactivity: HumanMolecular weight:Theoretical: 139 kDa. Actual: 150 kDa.Anti-GRSF1 Antibody (8Q610)
Antibody Type: Recombinant Rabbit Monoclonal
Application: WB,IHC-P,IHC-Fr,ICC/IF,IF,FCM
Reactivity: HumanMolecular weight:Theoretical: 53 kDa. Actual: 53 kDa.Anti-Phospho-Histone H1.4 (Thr17) Antibody (2W560)
Antibody Type: Recombinant Rabbit Monoclonal
Application: WB,IHC-P,IHC-Fr,ICC/IF,IF
Reactivity: Human,Mouse,RatMolecular weight:Theoretical: 22 kDa. Actual: 30 kDa.Anti-Pan Cytokeratin Polyclonal Antibody
Antibody Type: Rabbit Polyclonal
Application: FCM,ICC/IF,IF,IHC-Fr,IHC-P,WB
Reactivity: Human,Mouse,Rat,Cow (predicted:Chicken,Dog,Pig,Horse,Rabbit)Color and Shape:Odour LiquidHIV1 p24 antibody
HIV1 p24 antibody was raised in mouse using full length recombinant p24 (HIV-1) produced in baculovirus expression system as the immunogen.
Chlamydia antibody
Chlamydia antibody was raised in mouse using Chlamydia lipopolysaccharide as the immunogen.Streptococcus Group A antibody
Streptococcus group A antibody was raised in goat using group A Streptococci as the immunogen.
Purity:Min. 95%ApoC2 antibody
The ApoC2 antibody is a highly specific monoclonal antibody used in the field of Life Sciences. It is commonly utilized in solid phase assays to detect and quantify ApoC2, a protein involved in lipid metabolism. This antibody has a high affinity for ApoC2 and can be used in various research applications, including studying the role of ApoC2 in lipid transport and metabolism disorders.Purity:Min. 95%PrP 27-30 antibody
PrP 27-30 antibody was raised in goat using peptide (GQGGGTHSQWNKPSKPKTN) as the immunogen.Purity:Min. 95%Human Growth Hormone antibody
Human Growth Hormone antibody was raised in Rat using recombinant human growth hormone as the immunogen.CKMM antibody
CKMM antibody was raised in rabbit using human skeletal muscle purified CK-MM Isoenzyme as the immunogen.
Purity:Min. 95%Estrone 6 antibody
Estrone 6 antibody was raised in rabbit using estrone -6-oxime protein preparation as the immunogen.
Purity:Min. 95%Streptococcus Group A antibody
Streptococcus group A antibody was raised in goat using group A Streptococci as the immunogen.
Purity:Min. 95%Cry1Ab antibody
The Cry1Ab antibody is a monoclonal antibody used in the field of Life Sciences. It specifically targets a molecule known as Cry1Ab, which is a growth factor derivative. This antibody has been shown to inhibit the function of Cry1Ab, leading to disruptions in iron homeostasis and affecting the levels of proteins such as ferritin, fibrinogen, globulin, collagen, and hepatocyte growth factor. Additionally, this monoclonal antibody has demonstrated binding capabilities to other targets such as steroids and influenza hemagglutinin. Its high specificity and affinity make it an excellent tool for research purposes in studying the effects of Cry1Ab on various biological processes.HIV1 tat antibody (FITC)
HIV1 tat antibody (FITC) was raised in mouse using purified, full length Recombinant tat (HIV-1) produced in E.coli expression system as the immunogen.
Measles Virus Nucleoprotein antibody
Measles virus nucleoprotein antibody was raised in goat using full length recombinant measles virus nucleoprotein produced in baculovirus expression system as the immunogen.
Estradiol antibody
Estradiol antibody was raised in goat using 17 beta estradiol-3-BSA as the immunogen.
Ebola Virus antibody
The Ebola Virus antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that specifically targets the glycoprotein found on the surface of the Ebola virus. This antibody has been extensively studied and proven to be effective in neutralizing the virus by inhibiting its entry into host cells.
HIV1 p24 antibody (biotin)
HIV1 p24 antibody (biotin) was raised in rabbit using full length recombinant p24 (HIV-1) produced in baculovirus expression system as the immunogen.
Tau antibody
Tau antibody was raised in mouse using purified bovine microtubule-associated proteins as the immunogen.
Purity:Min. 95%Anti-HRVA16 di-uridylated antibody R2G - 0.2mg/mL
human rhinovirus (HRV) VPg uridylylation.
Purity:Min. 95%Progesterone 11 antibody
Progesterone 11 antibody was raised in rabbit using Progesterone-11-HSA as the immunogen.
Purity:Min. 95%S100 antibody
S100 antibody was raised in goat using bovine brain S-100 purified by SDS-PAGE as the immunogen.Purity:Min. 95%Chlorpyrifos antibody
The Chlorpyrifos antibody is a highly specialized protein that has been developed for use in the field of Life Sciences. This antibody is designed to specifically target and neutralize the effects of chlorpyrifos, a widely used insecticide. It works by binding to the chlorpyrifos molecules and preventing them from interacting with their intended targets.
Orosomucoid antibody
Orosomucoid antibody was raised in rabbit using rat alpha-1 acid glycoprotein as the immunogen.
Purity:Min. 95%Chlamydia trachomatis antibody (FITC)
Chlamydia trachomatis antibody (FITC) was raised in Mouse using LPS as the immunogen.
FITC antibody
FITC antibody was raised in rabbit using fluorescein isothiocyanate-KLH as the immunogen.
Purity:Min. 95%FABP antibody
FABP antibody was raised in goat using human fatty acid binding protein as the immunogen.
HSV1 gC antibody
HSV1 gC antibody was raised in mouse using herpes simplex virus gC-1 as the immunogen.
Macrophage Scavenger Receptor antibody
Macrophage scavenger receptor antibody was raised in goat using a peptide; RPGNSGPKGQKGEKGSGN, as the immunogen.Purity:Min. 95%Rabbit anti Mouse IgG3 (biotin)
Rabbit anti-mouse IgG3 (biotin) was raised in rabbit using murine IgG3 heavy chain as the immunogen.Purity:Min. 95%Neisseria Gonorrhoeae Antibody
Neisseria Gonorrhoeae Antibody is a highly specific monoclonal antibody used in Life Sciences research. It targets the chemokine receptors expressed on the surface of Neisseria gonorrhoeae, a bacteria responsible for causing gonorrhea. This antibody has been shown to neutralize the growth and spread of Neisseria gonorrhoeae by blocking its interaction with host cells. Additionally, it has been found to have an affinity for adiponectin receptors, which are involved in regulating adipose tissue function and metabolism. This antibody can be used in various research applications such as immunohistochemistry, flow cytometry, and ELISA assays to study the role of chemokines and adiponectin in disease progression and therapeutic interventions. Its high specificity and binding affinity make it a valuable tool for researchers studying infectious diseases and exploring new treatment options.
Goat anti Human Lambda light chain
Goat polyclonal anti Human Lambda light chain antibody
Purity:Min. 95%Anti-HRVA16 di-uridylated antibody R1G - 0.5mg/mL
human rhinovirus (HRV) VPg uridylylation.Purity:Min. 95%hCG antibody
hCG antibody was raised in mouse using hCG affinity pure from pregnancy urine as the immunogen.
IL6 antibody
The IL6 antibody is a monoclonal antibody that specifically targets interleukin-6 (IL-6), a cytokine involved in various inflammatory processes. This antibody has been designed to neutralize the activity of IL-6, thereby reducing inflammation and its associated symptoms. The IL6 antibody has shown promising results in preclinical studies, demonstrating its potential as a therapeutic option for conditions characterized by excessive IL-6 production, such as autoimmune diseases and certain types of cancer. This antibody is highly specific and does not cross-react with other cytokines or proteins, ensuring targeted and effective treatment. With its unique mechanism of action and high affinity for IL-6, the IL6 antibody holds great promise for improving patient outcomes in a wide range of inflammatory disorders.FABP antibody
FABP antibody was raised in goat using purifed FABP from human heart tissue as the immunogen.
Purity:Min. 95%HIV1 Nef antibody
HIV1 Nef antibody was raised in mouse using full length recombinant nef (HIV-1) as the immunogen.
Glucagon antibody
Glucagon antibody was raised in rabbit using porcine glucagon-BSA as the immunogen.
Purity:Min. 95%HIV1 gp41 antibody (biotin)
Mouse monoclonal HIV1 gp41 antibody (biotin); immunogen recombinant gp41; IgG1; Supplied in lyophilized form in PBS buffer
BNP antibody
Brain natriuretic peptide (BNP) circulates in blood as a peptide hormone with natriuretic, vasodilatory and renin inhibitory properties. BNP is secreted predominantly by the left ventricular myocytes in response to volume expansion and pressure overload. BNP belongs to a family of structurally similar peptide hormones, which includes atrial natriuretic peptide (ANP), BNP, C type natriuretic peptide (CNP) and urodilatin.
FGF9 antibody
FGF9 antibody was raised in rabbit using highly pure recombinant murine FGF-9 as the immunogen.
Purity:Min. 95%Estradiol 3 antibody
Estradiol-3 antibody was raised in rabbit using 17 beta Estradiol-3-BSA as the immunogen.
HTLV1 antibody (FITC)
HTLV-1 antibody (FITC) was raised in mouse using HTLV-1 (DIVmac251) as the immunogen.
Myoglobin antibody
Myoglobin antibody was raised in goat using human heart myoglobin as the immunogen.Purity:Min. 95%TSH antibody
TSH antibody is a highly specialized product used in Life Sciences research. It is a monoclonal antibody designed to specifically target and bind to TSH (thyroid-stimulating hormone). This antibody is commonly used in bioassays to study the antigen-antibody reaction and its effects on various biological processes.
Streptococcus Group B antibody
Streptococcus group B antibody was raised in rabbit using group B Streptococci as the immunogen.Purity:Min. 95%Desmoglein 2 antibody
Desmoglein 2 antibody was raised using the N terminal of DSG2 corresponding to a region with amino acids KIHSDLAEERGLKITYKYTGKGITEPPFGIFVFNKDTGELNVTSILDREEPurity:Min. 95%Buprenorphine antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting the active compounds responsible for bactericidal activity. Through its unique mechanism of action, this drug binds to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its efficacy has been demonstrated through extensive research using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique.HIV1 p24 antibody (FITC)
HIV1 p24 antibody (FITC) was raised in goat using purified, full length recombinant p24 (HIV-1 IIIB) produced in baculovirus expression system as the immunogen.
Anti-WT1 antibody - 3mg/mL
Wilms tumour 1 (WT1) is a zinc finger transcription factor that plays an important role in the development of several mesodermal tissues including: kidneys; gonads; coronary vasculature; cells within the liver; part of the intestine, and adipose tissue. WT1 is expressed during development, with levels within the developing kidney seen to increase as development proceeds. Postnatally WT1 expression is down-regulated, but upregulated in response to tissue damage in both mice and zebrafish. WT1 has an early role in kidney development and a later role in maintaining kidney function. Mutations in WT1 lead to Wilms tumour, a paediatric kidney cancer, as well as developmental anomalies in the urogenital tract. In zebrafish, two paralogous wt1 genes exist, wt1a and wt1b. The wt1 genes are expressed in a similar and overlapping but not identical pattern. This antibody is raised using an HPLC-purified peptide from a zinc finger domain of zebrafish WT1, an epitope found in both WT1a and WT1b.
3mg/ml. Used for ELISA (1:1000) and IHC (1:25000). Reacts with Danio rerio (Zebrafish).
Image provided courtesy of Dr. Elizabeth Patton Laboratory. University of Edinburgh: Notochord injury triggers local and sustained wt1b expression. Immunohistochemistry of the injured area with anti-GFP and anti-WT1 antibodies. n > 10; experimental replicates = 5. Scale bar: 20mm. dpf = days post fertilization; hpi = hours post injury; H and E = haematoxylin and eosin.Purity:Min. 95%ApoB antibody
ApoB antibody was raised in goat using human apolipoprotein B as the immunogen.
Purity:Min. 95%Vitamin B12 antibody
Vitamin B12 antibody was raised in rabbit using Vitamin B12-BSA as the immunogen.
Glucagon antibody
Glucagon antibody was raised in rabbit using porcine glucagon-BSA as the immunogen.
Purity:Min. 95%CD4 (T cell receptor) antibody (FITC)
Mouse monoclonal CD4 (T-cell) antibody (FITC); IgG1; 100 ug per vial; clone 45
Influenza A antibody
The Influenza A antibody is a monoclonal antibody used in the field of life sciences. It is commonly used for research purposes and has various applications in the study of influenza A virus. This antibody specifically targets and binds to antigens associated with the influenza A virus, allowing for the detection and analysis of viral proteins. Monoclonal antibodies like the Influenza A antibody have revolutionized scientific research by providing highly specific tools for studying various biological processes. They are widely used in immunohistochemistry, flow cytometry, and other techniques to identify and characterize specific molecules or cells. The Influenza A antibody can be used in combination with other antibodies or reagents to develop diagnostic tests or therapeutic interventions against influenza A infections. Its high affinity and specificity make it a valuable tool for researchers working on understanding the mechanisms of viral infection, developing vaccines, or testing antiviral drugs. In addition to its applications in virology, this monoclonal antibody has also beenhCG alpha antibody
hCG alpha antibody was raised in rabbit using hCG alpha as the immunogen.
Purity:Min. 95%Ebola Virus antibody
The Ebola Virus antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that exhibits cytotoxic properties against the Ebola virus. This antibody specifically targets and neutralizes the glycoprotein present on the surface of the virus, preventing it from infecting host cells.
Mouse anti Human IgG2 (Fab)
Human IgG2 antibody (Fab) was raised in mouse using human IgG2 (Fab portion) as the immunogen.
APP antibody
APP antibody was raised in goat using a synthetic peptide corresponding to amino acid residues 44-63 of the N-terminus of the human alzheimer’s APP as the immunogen.Purity:Min. 95%CMV p28 UL99 antibody
CMV p28 UL99 antibody was raised in mouse using cytomegalovirus minor capsid protein p28 as the immunogen.


