Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75448 products of "Primary Antibodies"
ITGA6 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. This medication is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. It works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication, thus preventing bacterial growth. The remarkable potency of this drug has been demonstrated through various scientific techniques like the patch-clamp technique on human erythrocytes. Additionally, it undergoes several metabolic transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and effectively inhibits their growth in culture
Methcathinone antibody
The Methcathinone antibody is a highly effective neutralizing agent used in the field of Life Sciences. It belongs to the class of Polyclonal Antibodies and is specifically designed to target autoantibodies. This antibody has shown remarkable efficacy in inhibiting the activity of acidic molecules such as β-catenin and TGF-beta1 (also known as TGF-β1). Additionally, it has been proven effective in blocking the action of trastuzumab, fibronectin, collagen, and alpha-fetoprotein. The Methcathinone antibody is widely recognized for its exceptional binding affinity and specificity towards TGF-beta, making it an invaluable tool in protein research and therapeutic applications.
Purity:Min. 95%CD79b antibody (PE)
CD79b antibody (biotin) was raised in hamster using the beta chain of the murine B-cell receptor as the immunogen.
Purity:Min. 95%LETMD1 antibody
LETMD1 antibody was raised using the middle region of LETMD1 corresponding to a region with amino acids LLRHRLKTHTTVIHQLDKALAKLGIGQLTAQEVKSACYLRGLNSTHIGED
Purity:Min. 95%HTR2C antibody
HTR2C antibody was raised in rabbit using the N terminal of HTR2C as the immunogenPurity:Min. 95%Complement C4 antibody
Complement C4 antibody was raised in goat using highly purified human complement protein as the immunogen.Purity:Min. 95%AMPK alpha antibody
The AMPK alpha antibody is a high-quality polyclonal antibody that is used in life sciences research. It specifically targets AMP-activated protein kinase (AMPK) alpha subunit and can be used for various applications such as immunohistochemistry, western blotting, and immunoprecipitation.
SET antibody
SET antibody was raised using the N terminal of SET corresponding to a region with amino acids IDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVT
Purity:Min. 95%Lp-PLA2 polyclonal antibody
Rabbit anti-human patelet-activating factor acetylhydrolase(Lp-PLA2) polyclonal Antibody
Purity:Min. 95%Cytokeratin 10 antibody
Cytokeratin 10 antibody is a highly specialized monoclonal antibody that targets the glycoprotein Cytokeratin 10. It is used for its neutralizing properties in various applications such as immunohistochemistry and Western blotting. This antibody has been extensively tested and validated to ensure its high specificity and sensitivity. It can effectively detect Cytokeratin 10 expression in adipose tissues, human serum, and other biological samples. Additionally, it has been shown to have cytotoxic effects on certain cancer cells when used in combination with active agents like Sn-38. With its exceptional binding affinity and ability to inhibit the activity of Cytokeratin 10, this antibody is a valuable tool for researchers studying autoimmune diseases, cancer biology, and interferon signaling pathways. Whether you are conducting basic research or developing diagnostic assays, this Cytokeratin 10 antibody will provide reliable and accurate results.
DHDDS antibody
DHDDS antibody was raised using the N terminal of DHDDS corresponding to a region with amino acids NRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFKR
TSGA13 antibody
TSGA13 antibody was raised using the middle region of TSGA13 corresponding to a region with amino acids ASERPISKVIREPLTLASLLEDMPTRTAPGESAFRNGRAPQWIIKKATVI
FOXM1 antibody
FOXM1 antibody was raised in rabbit using the N terminal of FOXM1 as the immunogen
Purity:Min. 95%GGT2 antibody
GGT2 antibody was raised in rabbit using the N terminal of GGT2 as the immunogen
Purity:Min. 95%FGF23 antibody
FGF23 antibody is a highly specialized antibody used in the field of Life Sciences. It specifically targets FGF23, a glycosylated protein involved in mineralization regulation. The FGF23 antibody has been developed to neutralize the activity of FGF23, making it an essential tool for researchers studying bone and mineral metabolism. This antibody is produced using advanced techniques, including colloidal gold labeling or microsphere conjugation, ensuring high specificity and sensitivity. Whether used in immunoassays or as a research tool, the FGF23 antibody provides valuable insights into the role of FGF23 and its signaling pathways, including protein kinase and 3-kinase activation.
phospho-Phospholamban antibody
Phospho-Phospholamban antibody was raised in rabbit using a synthetic peptide conjugated to KLH, corresponding to amino acids 14-25 of human cardiac phospholamban (RA[pS]TIEMPQQAR-C) as the immunogen.
Goat anti Rabbit IgG (FITC)
Goat anti-rabbit IgG (FITC) was raised in goat using rabbit IgG F(c) whole molecule as the immunogen.
Purity:Min. 95%hCG beta antibody
The hCG beta antibody is a protein that belongs to the Life Sciences category. It functions by binding to the nuclear factor kappa-light-chain-enhancer in order to regulate gene expression. This antibody is commonly used in research and diagnostic applications, particularly in the field of reproductive health. It has been shown to interact with various proteins, including mitogen-activated protein and β-catenin, which are involved in cellular signaling pathways. Additionally, this antibody has been found to have an inhibitory effect on the activity of p38 mitogen-activated protein phosphatase and caspase-9, both of which play important roles in cell growth and apoptosis. The hCG beta antibody is available as a monoclonal antibody, making it highly specific and reliable for use in experiments and assays requiring precise detection and analysis of target molecules.
UBXN6 antibody
UBXN6 antibody was raised in rabbit using the C terminal of UBXN6 as the immunogen
Purity:Min. 95%NRG1 antibody
NRG1 antibody was raised using the N terminal of NRG1 corresponding to a region with amino acids YMCKVISKLGNDSASANITIVESNEIITGMPASTEGAYVSSESPIRISVS
Purity:Min. 95%Goat anti Syrian Hamster IgG (H + L) (biotin)
Goat anti-syrian hamster IgG (H + L) (biotin) was raised in goat using hamster IgG (H & L) as the immunogen.
Purity:Min. 95%p63 antibody
The p63 antibody is a highly specialized antibody used in the field of Life Sciences. It is a nuclear antibody that reacts specifically with p63 protein, an essential regulator of cell growth and development. This polyclonal antibody is designed to recognize and bind to the activated form of p63 in various biological samples.
SEPP1 antibody
SEPP1 antibody was raised using the N terminal of SEPP1 corresponding to a region with amino acids LGLALALCLLPSGGTESQDQSSLCKQPPAWSIRDQDPMLNSNGSVTVVAL
YARS antibody
YARS antibody was raised using the C terminal of YARS corresponding to a region with amino acids QVEPLDPPAGSAPGEHVFVKGYEKGQPDEELKPKKKVFEKLQADFKISEE
HEXA antibody
HEXA antibody is a highly specific and potent polyclonal antibody used in life sciences research. It is also available as a monoclonal antibody. This antibody specifically targets the natriuretic hormone peptide, TGF-beta, and has neutralizing properties. It can be used to study the role of these hormones in various biological processes. Additionally, HEXA antibody has cytotoxic effects on cells expressing certain growth factors, making it a valuable tool for studying cell signaling pathways. Moreover, this antibody can be used in studies related to lipid metabolism as it targets enzymes such as triglyceride lipase and lipoprotein lipase. Its wide range of applications makes HEXA antibody an essential component of any research project in the fields of life sciences and medicine.
TIMP2 antibody
The TIMP2 antibody is a monoclonal antibody that specifically targets the necrosis factor-related apoptosis-inducing molecule. It is a neutralizing antibody that has been extensively studied in the field of Life Sciences. This antibody has shown great potential in inhibiting endothelial growth and angiogenesis, making it a valuable tool for research in the field of cancer biology and tumor development. Additionally, the TIMP2 antibody has been used to detect alpha-fetoprotein levels in human serum, making it an important tool for diagnostic purposes. With its high specificity and affinity for its target molecule, this antibody offers great promise for further advancements in the understanding and treatment of various diseases.
NT4 antibody
NT4 antibody was raised in mouse using highly pure recombinant human NT-4 as the immunogen.CHRNE antibody
CHRNE antibody was raised in rabbit using the N terminal of CHRNE as the immunogen
Purity:Min. 95%Caspase 7 antibody
The Caspase 7 antibody is a powerful inhibitory factor used in Life Sciences research. This polyclonal antibody specifically targets the protein caspase 7, which plays a crucial role in programmed cell death (apoptosis). By blocking the activity of caspase 7, this antibody allows researchers to investigate its function and explore its potential as a therapeutic target.
PERK antibody
The PERK antibody is a polyclonal antibody used in life sciences research. It is designed to specifically target and neutralize the activated form of PERK (protein kinase RNA-like endoplasmic reticulum kinase). This monoclonal antibody can be used for various applications, including Western blotting, immunoprecipitation, and immunofluorescence.
API5 antibody
The API5 antibody is an adeno-associated polypeptide that has the ability to bind to antigenic proteins and inhibit their activity. It is commonly used as a research tool in the development of inhibitors for various diseases. The API5 antibody has been shown to have a high affinity for heparin, which makes it an effective compound for inhibiting heparin cofactor activity. Additionally, this antibody can be used in the production of polyclonal antibodies, which are essential tools in biomedical research. It is also known to have autoantibodies properties and can be utilized in the development of medicines targeting serotonin-related disorders.
BAI1 antibody
BAI1 antibody was raised in rabbit using a synthetic peptide conjugated to KLHd as the immunogen.
Purity:Min. 95%MARK4 antibody
The MARK4 antibody is a polyclonal antibody that is used in life sciences research. It is specifically designed to target and bind to the MARK4 protein, which plays a crucial role in various cellular processes. This antibody can be used for molecular docking studies, as well as for the detection and quantification of MARK4 in biological samples.
Purity:Min. 95%MHC Class I antibody
The MHC Class I antibody is a potent mitogen that belongs to the group of monoclonal antibodies. It has been extensively studied in the field of Life Sciences for its cytotoxic and growth factor properties. This antibody specifically targets and activates MHC Class I molecules, which are essential for immune recognition and response. Additionally, it has been shown to play a role in collagen immobilization and neutralizing oncolytic adenovirus. With its ability to modulate dopamine and mitogen-activated protein signaling pathways, the MHC Class I antibody is a valuable tool for research in various areas of biology and medicine.
Cathepsin F antibody
The Cathepsin F antibody is a polyclonal antibody that specifically targets and binds to Cathepsin F, an acidic cysteine protease. Cathepsin F plays a crucial role in various physiological processes, including the degradation of extracellular matrix components such as fibronectin and collagen. This antibody is highly specific and can be used in various life science applications, including immunohistochemistry, Western blotting, and ELISA.
MKK3 antibody
The MKK3 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to specifically target and bind to alpha-fetoprotein, a glycoprotein that plays a crucial role in various biological processes. This antibody can be used in a variety of assays, including immunohistochemistry and Western blotting, to detect and quantify the presence of alpha-fetoprotein in samples.
Purity:Min. 95%DPP9 antibody
DPP9 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Purity:Min. 95%Influenza A antibody (FITC)
Influenza A antibody (FITC) was raised in mouse using Influenza A nucleoprotein as the immunogen.
Purity:Min. 95%Rad9 antibody
Rad9 antibody is a monoclonal antibody that specifically binds to Rad9, a protein involved in DNA damage response and repair. This antibody has been shown to be highly effective in detecting Rad9 in various biological samples, including pleural fluid and human serum. It can be used for research purposes in the field of life sciences to study the role of Rad9 in cellular processes such as DNA repair, cell cycle regulation, and apoptosis. Additionally, Rad9 antibody has antiangiogenic properties and can inhibit endothelial growth by binding to specific receptors on endothelial cells. Its cytotoxic effects make it a promising candidate for targeted cancer therapy. With its high specificity and affinity for Rad9, this antibody is an invaluable tool for scientists studying biomolecules and their interactions.
Norfentanyl antibody
Norfentanyl antibody is a highly specialized monoclonal antibody that is used to inhibit the activity of norfentanyl, a potent phosphatase inhibitor. This antibody specifically targets the amide group of norfentanyl and neutralizes its effects on cellular growth factors. It has been shown to effectively block the activation of tyrosine kinase receptors and prevent the binding of autoantibodies to growth hormone receptors. Norfentanyl antibody is widely used in life sciences research and has significant applications in studying cellular signaling pathways and understanding the role of growth factors in various physiological processes.Goat anti Syrian Hamster IgG (H + L) (FITC)
Goat anti-syrian hamster IgG (H + L) (FITC) was raised in goat using hamster IgG (H & L) as the immunogen.
Pirimiphos antibody
The Pirimiphos antibody is a highly effective antibody-drug that specifically targets TNF-α, a cytokine involved in inflammation and immune response. This polyclonal antibody is widely used in Life Sciences research to study the role of TNF-α and its receptor in various biological processes. It can be used for applications such as immunohistochemistry and Western blotting to detect and quantify TNF-α expression levels. The Pirimiphos antibody can also be conjugated with other molecules, such as doxorubicin, to create targeted therapies for specific diseases. With its high specificity and affinity, this monoclonal antibody offers a powerful tool for researchers studying growth factors, kinases, phosphatases, and carbonyl reductases. Its cytotoxic properties make it an ideal candidate for therapeutic applications aimed at eliminating cells expressing TNF-α.
COPS6 antibody
COPS6 antibody was raised in rabbit using the middle region of COPS6 as the immunogenPurity:Min. 95%mGluR1 alpha antibody
mGluR1 alpha antibody was raised in rabbit using a synthetic peptide comprising internal residues of the human GluR1 alpha protein as the immunogen.Purity:Min. 95%Histamine H3 Receptor antibody
The Histamine H3 Receptor antibody is a high-quality monoclonal antibody that specifically targets the histamine H3 receptor. This antibody is widely used in life sciences research, including studies on human histamine receptors, egf-like growth factors, and cytotoxic assays. It has been proven to be highly effective in various applications, such as Western blotting, immunohistochemistry, and flow cytometry.
TACC3 antibody
The TACC3 antibody is a highly specialized antibody that plays a crucial role in various biological processes. It is commonly used in the field of Life Sciences for research purposes. This antibody specifically targets TACC3, which stands for transforming acidic coiled-coil-containing protein 3. TACC3 is involved in cell division, growth regulation, and development.
FAM98A antibody
FAM98A antibody was raised using the middle region of FAM98A corresponding to a region with amino acids QKRQDGPQQQTGGRGGGRGGYEHSSYGGRGGHEQGGGRGGRGGYDHGGRG
ARL3 antibody
ARL3 antibody was raised in rabbit using the N terminal of ARL3 as the immunogen
Purity:Min. 95%Calcitonin antibody
The Calcitonin antibody is an anti-connexin agent that specifically targets transthyretin. It is used for immobilization on electrodes and in interferon assays. This monoclonal antibody has been shown to be highly effective in detecting and quantifying activated tyrosine in human serum, making it a valuable tool in Life Sciences research. With its high specificity and sensitivity, this antibody is widely used in various applications, including antigen detection and characterization. Trust the Calcitonin antibody to deliver accurate and reliable results in your research endeavors.Mouse anti Human IgM (HRP)
IgM antibody was raised in Mouse using recombinant human IgM as the immunogen.Purity:Min. 95%SLC22A1 antibody
SLC22A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSCVDPLASLATNRSHLPLGPCQDGWVYDTPGSSIVTEFNLVCADSWKLD
CD45.1 antibody (Allophycocyanin-CY7)
CD45 antibody (Allophycocyanin) was raised in Rat using CD45/LCA as the immunogen.
Purity:Min. 95%Goat anti Human IgG (Alk Phos)
Goat anti-human IgG (Alk Phos) was raised in goat using human IgG F(c) fragment as the immunogen.
Purity:Min. 95%MTAP antibody
The MTAP antibody is a highly specialized product in the field of Life Sciences. It is a nuclear monoclonal antibody that has been developed for various applications, including antinociceptive research. This antibody specifically targets the retinoid-binding protein MTAP, which is found in high levels in certain tissues and cells.
XAF1 antibody
The XAF1 antibody is a high-quality monoclonal antibody that specifically binds to XAF1 protein, an important regulator of apoptosis. This antibody can be used for the treatment and/or prophylaxis of various diseases, including cancer. The XAF1 antibody has been extensively tested in both in vitro and in vivo studies, demonstrating its efficacy in inducing apoptosis in cancer cells.
ATF4 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is known for its bactericidal activity against tuberculosis infection and contains active compounds that effectively inhibit bacterial growth. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its efficacy has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. The metabolization process involves hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Furthermore, this drug specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting their cell growth in culture.
