Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
IgG1 antibody
The IgG1 antibody is a highly versatile and potent medicament that belongs to the class of antibodies. It is activated upon binding to specific antigens, leading to cytotoxic effects on target cells. IgG1 antibodies play a crucial role in the immune response by neutralizing pathogens and promoting phagocytosis. These antibodies are widely used in life sciences research, diagnostics, and therapeutic applications.
FANCA antibody
The FANCA antibody is a monoclonal antibody that is used in Life Sciences research. It specifically targets and binds to the FANCA protein, which plays a crucial role in DNA repair and maintenance. By binding to FANCA, this antibody inhibits its proteolytic activity, preventing it from degrading important cellular components.
Troponin I antibody (Cardiac)
Troponin I antibody (cardiac) was raised in mouse using amino acid residues 26-35 of cTnI as the immunogen.
KYNU antibody
KYNU antibody is a polyclonal antibody that specifically targets kynureninase (KYNU), an enzyme involved in the metabolism of tryptophan. KYNU plays a crucial role in the production of kynurenic acid, which has been implicated in various neurological and psychiatric disorders. This antibody can be used in research assays to detect and quantify KYNU levels in biological samples, allowing for a better understanding of its function and potential therapeutic applications. With its high specificity and sensitivity, the KYNU antibody is a valuable tool for scientists and researchers working in the field of life sciences. Whether studying autoimmune diseases, developing new medicines, or exploring the role of kynurenine pathway intermediates, this antibody provides reliable results and contributes to advancements in biomedical research.
Bax antibody
The Bax antibody is a monoclonal antibody that specifically targets the protein Bax. Bax plays a crucial role in regulating cell death and apoptosis. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research applications.
GFAP antibody
The GFAP antibody is a highly specialized antibody that targets glial fibrillary acidic protein (GFAP). This protein is primarily expressed in astrocytes, a type of glial cell in the central nervous system. The GFAP antibody has been extensively used in various research fields, including Life Sciences and Neuroscience.
PTS antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to target tuberculosis infections and contains active compounds with bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, effectively inhibiting bacterial growth and preventing transcription and replication. The effectiveness of this drug has been extensively studied using advanced techniques like the patch-clamp technique on human erythrocytes. Additionally, it undergoes various metabolic transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.
GAP43 antibody
The GAP43 antibody is a polyclonal antibody that is widely used in life sciences research. It is commonly used to study the role of interferon in cellular processes. The antibody is produced by immunizing animals with GAP43, a protein found in the nervous system. It has high specificity and affinity for its target, making it an ideal tool for detecting and quantifying GAP43 levels in various biological samples.
PLEKHF1 antibody
The PLEKHF1 antibody is a highly specialized monoclonal antibody that serves as a serum marker for various medical conditions. This antibody specifically targets and binds to the PLEKHF1 antigen, which plays a crucial role in the regulation of interleukin production and immune response. By inhibiting the activity of PLEKHF1, this antibody can be used as a potential medicament in the treatment of autoimmune diseases, inflammatory disorders, and certain types of cancers.
HPRT antibody
The HPRT antibody is a highly specialized monoclonal antibody that is used in various assays and experiments in the field of Life Sciences. It specifically targets the hypoxanthine-guanine phosphoribosyltransferase (HPRT) enzyme, which plays a crucial role in the metabolism of purine nucleotides.
GEM antibody
GEM antibody was raised using the C terminal of GEM corresponding to a region with amino acids FSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKL
NSE antibody
The NSE antibody is a highly specialized monoclonal antibody that is used in various medical applications. It is commonly used in electrophoresis and high-dose chemotherapy procedures. This antibody specifically targets histone deacetylase inhibitors, which are involved in regulating gene expression and cell growth.
STMN1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to target tuberculosis infections and contains active compounds with bactericidal activity. Through extensive research, it has been determined that this drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, effectively preventing transcription and replication.
PPCDC antibody
PPCDC antibody was raised using the N terminal of PPCDC corresponding to a region with amino acids VTTERAKHFYSPQDIPVTLYSDADEWEIWKSRSDPVLHIDLRRWADLLLV
LOXL2 antibody
The LOXL2 antibody is a powerful tool in the field of Life Sciences. It is an antibody that specifically targets and binds to LOXL2, a protein involved in various biological processes. This antibody has been extensively studied and proven to be effective in detecting and quantifying LOXL2 levels in different samples.
BAD antibody
The BAD antibody is a polyclonal antibody that specifically targets the BAD protein. BAD (Bcl-2 associated death promoter) is a key regulator of apoptosis, or programmed cell death. This antibody is widely used in life sciences research to study the role of BAD in various cellular processes.
RTP4 antibody
RTP4 antibody was raised using a synthetic peptide corresponding to a region with amino acids SSDSTMRILSNLVQHILKKYYGNGTRKSPEMPVILEVSLEGSHDTANCEA
Desmocollin 1 antibody
Desmocollin 1 antibody was raised in mouse using synthetic peptide corresponding to sequence present within the intracellular part of human desmocollin 1 as the immunogen.Chlamydia trachomatis antibody (FITC)
Chlamydia trachomatis antibody (FITC) was raised in rabbit using L2 and other serovar groups as the immunogen.
AMPD1 antibody
The AMPD1 antibody is a highly specialized product in the field of Life Sciences. It is an activated monoclonal antibody that specifically targets and detects AMPD1, an enzyme involved in fatty acid metabolism. This antibody has been extensively tested and validated for its specificity and sensitivity in various applications.
MCM2 antibody
The MCM2 antibody is a highly specialized growth factor that targets adipose tissue. It specifically binds to the adiponectin receptor, promoting the activation of epidermal growth factors and chemokines. This antibody has been shown to enhance the production of adiponectin, interferon, and dopamine in adipose cells.
FHL2 antibody
The FHL2 antibody is a polyclonal antibody that specifically targets hepatocyte growth factor (HGF), a potent growth factor involved in various biological processes. This antibody can be used for immobilization or activation of HGF in different experimental setups. It is also available as a monoclonal antibody, which offers high specificity and reproducibility. The FHL2 antibody has been shown to have cytotoxic effects on certain cancer cell lines, making it a valuable tool in cancer research. Additionally, this antibody can neutralize the activity of angptl3, a glycoprotein involved in lipid metabolism. Its ability to function at low pH levels further enhances its versatility in various life science applications.
PER2 antibody
The PER2 antibody is a highly specialized monoclonal antibody that is widely used in the field of Life Sciences. It is specifically designed to target and bind to the PER2 protein, which plays a crucial role in regulating circadian rhythms. This antibody has been extensively validated using mass spectrometric methods and has shown exceptional specificity and sensitivity.
Tyrosine Hydroxylase antibody
The Tyrosine Hydroxylase antibody is a powerful tool used in Life Sciences research. This monoclonal antibody specifically targets and detects tyrosine hydroxylase, an enzyme involved in the synthesis of dopamine, a neurotransmitter that plays a crucial role in various physiological processes. The Tyrosine Hydroxylase antibody recognizes an epitope located within the protein sequence of tyrosine hydroxylase, allowing for precise and accurate detection.
TOM20 antibody
The TOM20 antibody is a monoclonal antibody that has a wide range of applications in the field of Life Sciences. It specifically targets TOM20, a protein involved in mitochondrial import and sorting. This antibody can be used for various research purposes, including the detection and quantification of TOM20 in different biological samples.
TLR4 antibody
The TLR4 antibody is a reactive and neutralizing monoclonal antibody that targets Toll-like receptor 4 (TLR4). It is commonly used in research and clinical settings to study the role of TLR4 in various biological processes. This antibody specifically binds to TLR4, preventing its interaction with ligands and downstream signaling molecules. By blocking TLR4 activation, the antibody inhibits the production of pro-inflammatory cytokines such as interleukin-6 (IL-6) and tumor necrosis factor-alpha (TNF-α). Additionally, it has been shown to inhibit the genotoxic effects of certain substances, making it a valuable tool in genotoxicity studies. The TLR4 antibody is widely used in life sciences research, particularly in the fields of immunology and inflammation. Whether you're studying cholinergic signaling or investigating fatty acid metabolism, this antibody can provide valuable insights into cellular processes regulated by TLR4. Choose our high-quality TLR4 antibody for your
TNF alpha antibody
TNF alpha antibody is a glycoprotein that contains sugar moieties and belongs to the epidermal growth factor (EGF)-like family. It acts as a growth factor and plays a crucial role in various biological processes. This antibody specifically targets TNF-α, a pro-inflammatory cytokine involved in immune responses and inflammatory diseases.
TGFBI antibody
The TGFBI antibody is a highly specialized product in the field of Life Sciences. It is an antibody that specifically targets and binds to the Transforming Growth Factor Beta-Induced (TGFBI) protein. This protein plays a crucial role in various biological processes, including cell adhesion, migration, and tissue development.
CRELD1 antibody
CRELD1 antibody was raised using the C terminal of CRELD1 corresponding to a region with amino acids TEVCPGENKQCENTEGGYRCICAEGYKQMEGICVKEQIPESAGFFSEMTE
MVP antibody
The MVP antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to dinitrophenyl (DNP) antigens, making it a valuable tool for studying immune responses. This antibody has been shown to have neutralizing effects on interferon and endothelial growth factors, inhibiting their activity. Additionally, the MVP antibody has been found to induce lysis of target cells in the presence of complement or human serum. Its ability to inhibit caspase-9 activation suggests a potential role in apoptosis regulation. Furthermore, this monoclonal antibody has been shown to immobilize β-catenin, an important protein involved in cell adhesion and signaling pathways. These unique characteristics make the MVP antibody an essential tool for researchers studying antiangiogenic and growth factor-related processes in various biological systems.
p63 antibody
The p63 antibody is a highly specialized antibody used in the field of Life Sciences. It is a nuclear antibody that reacts specifically with p63 protein, an essential regulator of cell growth and development. This polyclonal antibody is designed to recognize and bind to the activated form of p63 in various biological samples.
ICAM2 antibody
ICAM2 antibody is a growth factor that plays a crucial role in various cellular processes. It has been shown to be involved in the regulation of immune responses, cell adhesion, and signal transduction. This antibody specifically targets ICAM2, an antigen expressed on the surface of cells.
ARD1A antibody
ARD1A antibody was raised using a synthetic peptide corresponding to a region with amino acids VESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSE
RAP1GDS1 antibody
The RAP1GDS1 antibody is a monoclonal antibody that specifically targets annexin A2. It is widely used in Life Sciences research for various applications, including immunohistochemistry, Western blotting, and flow cytometry. Annexin A2 plays a crucial role in cell signaling pathways, particularly those involving epidermal growth factor (EGF), low-density lipoprotein (LDL) receptor-related protein 1 (LRP1), basic protein (BP), collagen, endothelial growth factor (EGF), and transforming growth factor-beta (TGF-beta). This antibody allows researchers to study the expression and localization of annexin A2 in different cell types and tissues. With its high specificity and sensitivity, the RAP1GDS1 antibody is an invaluable tool for understanding the functions of annexin A2 in cellular processes and disease mechanisms.
