Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
Methamphetamine antibody
Methamphetamine antibody was raised in mouse using methamphetamine-BSA as the immunogen.
Purity:Min. 95%Snx10 antibody
Snx10 antibody was raised in rabbit using the middle region of Snx10 as the immunogenPurity:Min. 95%CD117 antibody (Spectral Red)
CD117 antibody (biotin) was raised in rat using murine CD117/c-Kit as the immunogen.
Purity:Min. 95%PPP1R3A antibody
PPP1R3A antibody was raised using a synthetic peptide corresponding to a region with amino acids MEPSEVPSQISKDNFLEVPNLSDSLCEDEEVTFQPGFSPQPSRRGSDSSEPurity:Min. 95%CD11b antibody (Spectral Red)
CD11b antibody (PE) was raised in rat using C57BL/10 murine splenic T-cells and concanavalin A-activted C57BL/10 splenocytes as the immunogen.
Purity:Min. 95%CD3e antibody (FITC)
CD3e antibody (FITC) was raised in mouse using porcine CD3e as the immunogen.
Purity:Min. 95%SFTPD antibody
The SFTPD antibody is a substance that belongs to the group of antibodies. It is commonly used in gas-liquid interface studies and has been shown to have antinociceptive properties, meaning it can inhibit pain sensation. In Life Sciences, this antibody is often used as an inhibitor to study the function of specific proteins or pathways. Additionally, the SFTPD antibody has been used in research related to collagen and its role in diseases and therapeutics. It is a polyclonal antibody, meaning it recognizes multiple epitopes on its target protein. This makes it a versatile tool for various applications, including vaccine strain development and the development of new medicines.
ACADL antibody
The ACADL antibody is a neurotrophic factor monoclonal antibody that has shown promising results in various studies. This antibody acts as a growth factor and has the ability to promote cell survival and differentiation. It can be used in research settings to study the effects of neurotrophic factors on neuronal development and function.
p70S6 Kinase antibody
The p70S6 Kinase antibody is a highly effective selectable marker used in various research applications. This antibody is designed to specifically target and bind to p70S6 Kinase, a key enzyme involved in the regulation of protein synthesis and cell growth. It is available as both monoclonal and polyclonal antibodies, providing researchers with options depending on their specific needs.
Purity:Min. 95%CD24 antibody (Spectral Red)
CD24 antibody (Spectral Red) was raised in rat using murine heat stable antigen as the immunogen.
Purity:Min. 95%SHP2 antibody
The SHP2 antibody is a highly specialized antibody that targets specific molecules in the body. It has been extensively studied and proven to be effective in various applications. This antibody has the ability to bind to collagen, erythropoietin, TNF-related apoptosis-inducing ligand (TRAIL), autoantibodies, and disulfide bonds. It has also been shown to react with human serum proteins such as alpha-fetoprotein.
Purity:Min. 95%BAG3 antibody
BAG3 antibody was raised using the middle region of BAG3 corresponding to a region with amino acids NVTRPAAQPSFHQAQKTHYPAQQGEYQTHQPVYHKIQGDDWEPRPLRAAS
Purity:Min. 95%Keratin K27 antibody
Keratin K27 antibody was raised in Guinea Pig using synthetic peptide of human keratin K27 coupled to KLH as the immunogen.
Purity:Min. 95%RAB11FIP5 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, which prevents transcription and replication, inhibiting bacterial growth. The efficacy of this drug has been demonstrated through the use of a patch-clamp technique on human erythrocytes.
Goat anti Human IgG (H + L) (rhodamine)
This antibody reacts with heavy chains on human IgG (gamma chain) and light chains on all human immunoglobulins.
Purity:Min. 95%AML1 antibody
The AML1 antibody is a highly specialized Polyclonal Antibody used in immunosuppressant therapies. It is designed to target protein-protein interactions involving AML1, a transcription factor that plays a crucial role in the development of various blood cells. This antibody is derived from colloidal gold and calmodulin, ensuring its high specificity and affinity for AML1. The monoclonal nature of this antibody allows for precise targeting and binding to AML1-expressing cells.
Goat anti Chicken IgG (H + L)
Goat anti-chicken IgG (H+L) was raised in goat using chicken IgG, whole molecule as the immunogen.
Purity:Min. 95%GTPBP9 antibody
GTPBP9 antibody was raised using a synthetic peptide corresponding to a region with amino acids QGLGNAFLSHISACDGIFHLTRAFEDDDITHVEGSVDPIRDIEIIHEELQ
RPS15 antibody
RPS15 antibody was raised using the middle region of RPS15 corresponding to a region with amino acids GVYNGKTFNQVEIKPEMIGHYLGEFSITYKPVKHGRPGIGATHSSRFIPL
PKC delta antibody
The PKC delta antibody is a powerful tool used in life sciences research. It specifically targets and detects the protein kinase C delta (PKC δ), which plays a crucial role in cell signaling pathways. This polyclonal antibody can be used to study various biological processes, including androgen and epidermal growth factor signaling, histidine phosphorylation, and cholinergic neurotransmission.
Purity:Min. 95%AGT antibody
AGT antibody was raised using a synthetic peptide corresponding to a region with amino acids IHPFHLVIHNESTCEQLAKANAGKPKDPTFIPAPIQAKTSPVDEKALQDQ
Purity:Min. 95%DGKE antibody
DGKE antibody was raised using the N terminal of DGKE corresponding to a region with amino acids EAERRPAPGSPSEGLFADGHLILWTLCSVLLPVFITFWCSLQRSRRQLHRPurity:Min. 95%SH1 antibody
The SH1 antibody is a polyclonal antibody that has been developed as a potential biological tool for studying tumor biomarkers. It specifically targets the IL-17A antigen, which is known to be involved in various protein-protein interactions and signaling pathways. The SH1 antibody can be used in various life science applications, including immunohistochemistry, western blotting, and ELISA assays. It has been shown to exhibit strong inhibition effects on IL-17A activity in vitro and in vivo. The SH1 antibody is produced using a eukaryotic expression vector and synthetic techniques, ensuring high purity and specificity. With its unique characteristics and versatility, the SH1 antibody is an essential tool for researchers investigating IL-17A-related pathways and exploring potential therapeutic interventions.
HIF3A antibody
HIF3A antibody was raised in rabbit using the C terminal of HIF3A as the immunogen
Purity:Min. 95%KBTBD10 antibody
KBTBD10 antibody was raised in rabbit using the N terminal of KBTBD10 as the immunogen
Purity:Min. 95%HS3ST5 antibody
HS3ST5 antibody was raised using a synthetic peptide corresponding to a region with amino acids SQYNLYFNATRGFYCLRFNIIFNKCLAGSKGRIHPEVDPSVITKLRKFFH
Purity:Min. 95%TMEM30A antibody
TMEM30A antibody was raised using the N terminal of TMEM30A corresponding to a region with amino acids FTLEKSFEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDSSALLNPSKECPurity:Min. 95%AND1 antibody
AND1 antibody was raised in mouse using Nuclear fraction prepared from Xenopus laevis oocytes as the immunogen.AKR1C1 antibody
The AKR1C1 antibody is a potent family kinase inhibitor that targets specific growth factors, such as glucagon and epidermal growth factor. It is a polyclonal antibody that has been developed for neutralizing the effects of these growth factors in various biological systems. The antibody is formulated with excipients to ensure stability and efficacy. It can be used in various life science applications, including research and diagnostics. Additionally, the AKR1C1 antibody can also target other proteins, such as β-catenin, chemokines, alpha-fetoprotein, and globulins. Its specificity and effectiveness make it an essential tool for studying protein-protein interactions and cellular signaling pathways.
Purity:Min. 95%Metaxin 2 antibody
Metaxin 2 antibody was raised using the N terminal of MTX2 corresponding to a region with amino acids YIAAEPWPENATLYQQLKGEQILLSDNAASLAVQAFLQMCNLPIKVVCRA
SRPRB antibody
SRPRB antibody was raised using the middle region of SRPRB corresponding to a region with amino acids QDIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLYSSSTAPAQLGKKGKE
Purity:Min. 95%HDAC5 antibody
The HDAC5 antibody is a highly specialized product used in Life Sciences research. It is an antibody that specifically targets atypical hemolytic autoantibodies. This antibody has neutralizing properties, meaning it can inhibit the activity of these autoantibodies, preventing them from causing damage to red blood cells. The HDAC5 antibody is produced using state-of-the-art techniques and has been extensively tested for its efficacy and specificity.
Purity:Min. 95%Protein C antibody
Protein C antibody was raised in goat using human Protein C purified from plasma as the immunogen.Purity:Min. 95%Plakophilin 2 antibody
Plakophilin 2 antibody was raised in Guinea Pig using human synthetic plakophilin 2 as the immunogen.Purity:Min. 95%ATG5 antibody
ATG5 antibody was raised using a synthetic peptide corresponding to a region with amino acids DPEDGEKKNQVMIHGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTDPurity:Min. 95%Rabbit anti Guinea Pig IgG (H + L) (rhodamine)
Rabbit anti-guinea pig IgG (H+L) (Rhodamine) was raised in rabbit using guinea pig IgG whole molecule as the immunogen.
Purity:Min. 95%PMVK antibody
The PMVK antibody is a highly specialized antibody that plays a crucial role in the immune response. It is activated by interferon-gamma (IFN-gamma) and exhibits cytotoxic activity against target cells. This antibody specifically targets tyrosine residues on growth factors, leading to their neutralization and inhibition of cell proliferation. Additionally, the PMVK antibody has been shown to bind to annexin proteins, which are involved in apoptotic processes. This monoclonal antibody is produced using cutting-edge technology and is highly specific for its target antigen. It has been widely used in life sciences research, including studies on adenine metabolism and the development of antiviral therapies.
Goat anti Human IgG (H + L) (HRP)
Goat anti-human IgG (H+L) (HRP) was raised in goat using human IgG whole molecule as the immunogen.Purity:Min. 95%Hamster Lymphocyte antibody
Hamster lymphocyte antibody was raised in rabbit using RBC-free hamster thymus and spleen cells as the immunogen.Purity:Min. 95%Donkey anti Rabbit IgG (H + L)
This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.Purity:Min. 95%Trazodone antibody
The Trazodone antibody is a reactive monoclonal antibody that falls under the category of Life Sciences. It is specifically designed to target and neutralize tumor necrosis factor-alpha (TNF-α) and interleukin (IL), which are key inflammatory factors in the body. This antibody has shown inhibitory effects on adipose tissue and chemokine production, making it a potential therapeutic option for conditions associated with inflammation and immune dysregulation. Additionally, the Trazodone antibody has been found to have neutralizing activity against Brucella abortus, a bacterium that causes brucellosis in animals and humans. This suggests its potential use in treating infections caused by this pathogen. Furthermore, this antibody exhibits inhibitory effects on family kinase inhibitors and calmodulin, which are involved in various cellular processes such as signal transduction and calcium signaling. By targeting these proteins, the Trazodone antibody may have implications for the treatment of diseases related to their dysPurity:Min. 95%Borrelia burgdorferi antibody
Borrelia burgdorferi antibody was raised in rabbit using a whole cell preparation from Borrelia burgdorferi as the immunogen.Purity:Min. 95%CKB antibody
The CKB antibody is a polyclonal antibody that specifically targets the creatine kinase B (CKB) protein. This antibody is widely used in Life Sciences research to study various cellular processes and signaling pathways. The CKB protein plays a crucial role in energy metabolism by catalyzing the reversible transfer of phosphate between ATP and creatine, thus providing a readily available source of energy for cells. It is primarily expressed in tissues with high-energy demands, such as skeletal muscle, heart, and brain.
Goat anti Cat IgG (H + L)
Goat anti-cat IgG (H+L) was raised in goat using feline IgG whole molecule as the immunogen.
Purity:Min. 95%RAGE antibody
The RAGE antibody is a glycation-specific polyclonal antibody that targets the receptor for advanced glycation end products (RAGE). This antibody plays a crucial role in various pathological conditions, including thrombotic microangiopathy and atypical hemolytic uremic syndrome. It binds to RAGE and inhibits the interaction between RAGE and its ligands, such as advanced glycation end products (AGEs) and high mobility group box 1 (HMGB1). By blocking this interaction, the RAGE antibody can prevent the activation of downstream signaling pathways involved in inflammation and tissue damage. Additionally, this antibody has been used in research studies to investigate the role of RAGE in various diseases, including cancer and neurodegenerative disorders. The RAGE antibody is available as both monoclonal and polyclonal antibodies, providing researchers with options to suit their specific experimental needs.
Purity:Min. 95%DTL antibody
DTL antibody was raised using a synthetic peptide corresponding to a region with amino acids VNQISGAHNTSDKQTPSKPKKKQNSKGLAPSVDFQQSVTVVLFQDENTLV
Mouse anti Human IgA
IgA antibody was raised in Mouse using recombinant human IgA2 as the immunogen.Purity:Min. 95%Morphine antibody
Morphine antibody was raised in mouse using Morphine-3-BSA as the immunogen.Purity:Min. 95%CD24 antibody (PE)
CD24 antibody (PE) was raised in rat using murine heat stable antigen as the immunogen.
Purity:Min. 95%GDF15 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication, thereby preventing the growth of bacteria. Its efficacy has been demonstrated through extensive studies using advanced techniques such as patch-clamp on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.
Purity:Min. 95%MKK6 antibody
The MKK6 antibody is a highly specialized polyclonal antibody used in Life Sciences research. It specifically targets the activated form of MKK6, a key enzyme involved in the natriuretic signaling pathway. This antibody has been extensively tested and validated for its specificity and sensitivity in detecting MKK6 activation in various experimental settings.
Purity:Min. 95%Tetraspanin 31 antibody
Tetraspanin 31 antibody was raised using the middle region of TSPAN31 corresponding to a region with amino acids CTAICKSQSPTCQMCGEKFLKHSDEALKILGGVGLFFSFTEILGVWLAMRPurity:Min. 95%SLC26A10 antibody
SLC26A10 antibody was raised in rabbit using the N terminal of SLC26A10 as the immunogen
Purity:Min. 95%SULT2B1 antibody
SULT2B1 antibody was raised using the N terminal of SULT2B1 corresponding to a region with amino acids MASPPPFHSQKLPGEYFRYKGVPFPVGLYSLESISLAENTQDVRDDDIFI
PSMC5 antibody
PSMC5 antibody was raised in rabbit using the C terminal of PSMC5 as the immunogen
Purity:Min. 95%SLPI antibody
SLPI antibody was raised in rabbit using the N terminal of SLPI as the immunogen
Purity:Min. 95%ETV1 antibody
ETV1 antibody was raised in rabbit using the N terminal of ETV1 as the immunogen
Purity:Min. 95%CD8a antibody (biotin)
CD8a antibody (biotin) was raised in Mouse using the alpha chainc of chicken CD8 as the immunogen.
Purity:Min. 95%SOCS1 antibody
SOCS1 antibody was raised using the N terminal of SOCS1 corresponding to a region with amino acids RRPEPSSSSSSSPAAPARPRPCPAVPAPAPGDTHFRTFRSHADYRRITRA
ZNF764 antibody
ZNF764 antibody was raised in rabbit using the N terminal of ZNF764 as the immunogen
Purity:Min. 95%FABP antibody
FABP antibody is a growth factor that has been modified with colloidal acid to enhance its neutralizing properties. It specifically targets lipoprotein lipase and inhibits its activity, making it an effective tool in studying the role of lipoproteins in various biological processes. This antibody has undergone glycosylation, which improves its stability and bioavailability. FABP antibody is commonly used in Life Sciences research, particularly in studies involving interferon and monoclonal antibodies. It can be immobilized on cellulose for purification purposes or used as a detection tool in assays. Whether you need a monoclonal or polyclonal antibody, FABP antibody is a valuable tool for your research needs.
Goat anti Human IgM (mu chain) (HRP)
This antibody reacts with heavy chains on human IgM (mu chain).Purity:Min. 95%p73 antibody
The p73 antibody is a highly specialized polyclonal antibody used in the field of Life Sciences. It is designed to specifically target and bind to the p73 protein, which plays a crucial role in various cellular processes including cell growth, differentiation, and apoptosis. This antibody has been extensively tested and validated for its high specificity and sensitivity.
Purity:Min. 95%
