Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
PDIA4 antibody
The PDIA4 antibody is a highly specific monoclonal antibody that targets the protein disulfide isomerase A4 (PDIA4). This antibody has been extensively studied for its role in various biological processes, including fatty acid metabolism, lipoprotein lipase activity, and collagen synthesis. It has also been shown to modulate the viscosity of human serum and play a crucial role in cell signaling pathways, such as hepatocyte growth factor and fibronectin signaling.
Calcium binding protein p22 antibody
Affinity purified Rabbit polyclonal Calcium binding protein p22 antibody
Factor IX antibody
Factor IX antibody is a highly specialized polyclonal antibody that targets and neutralizes the activity of Factor IX, a crucial protein involved in blood clotting. This antibody is widely used in Life Sciences research and diagnostic applications. It has been extensively studied for its potential therapeutic use as an anti-her2 antibody, monoclonal antibody, and family kinase inhibitor. Factor IX antibody has also been shown to have an inhibitory effect on interferon, chemokine, and epidermal growth factor signaling pathways. Its high specificity and affinity make it an ideal tool for various immunoassays, including enzyme-linked immunosorbent assays (ELISA) and Western blotting. Additionally, this antibody can be conjugated with different molecules or labeled with spectrometric tags for advanced detection methods. With its lysine-specific binding properties, Factor IX antibody offers researchers a valuable resource for studying blood coagulation disorders and developing targeted therapies.
HGF antibody (biotin)
HGF antibody (biotin) was raised in goat using S. frugiperda insect ovarian cell line Sf 21-derived recombinant human HGF as the immunogen.UMOD antibody
UMOD antibody was raised in rabbit using the C terminal of UMOD as the immunogen
Purity:Min. 95%TIMP3 antibody
The TIMP3 antibody is a monoclonal antibody that targets the tissue inhibitor of metalloproteinase 3 (TIMP3). TIMP3 plays a crucial role in regulating endothelial growth and inhibiting the activity of metalloproteinases, which are enzymes involved in tissue remodeling. This antibody specifically binds to TIMP3 and can be used for various research purposes in the field of life sciences.
c-Jun antibody
The c-Jun antibody is a specific monoclonal antibody that targets the polymorphic protein known as c-Jun. This antibody is widely used in the field of life sciences for research purposes. It has been shown to effectively detect and bind to c-Jun, allowing for the study of its functions and interactions within cells.
Purity:Min. 95%SNRP70 antibody
SNRP70 antibody was raised using a synthetic peptide corresponding to a region with amino acids YLPPLEKLPHEKHHNQPYCGIAPYIREFEDPRDAPPPTRAETREERMERK
IGF2BP2 antibody
The IGF2BP2 antibody is a highly specialized antibody that targets the transferrin receptor in the nucleus of cells. This antibody is widely used in Life Sciences research to study various cellular processes, including exocytosis, cell signaling, and protein synthesis. The IGF2BP2 antibody specifically binds to the antigen on the cell surface and facilitates the internalization of transferrin into the cell. This process is crucial for proper iron metabolism and cellular homeostasis. Additionally, this monoclonal antibody has been shown to have antimicrobial properties against certain bacteria, such as those expressing alpha-gal epitopes. Its unique mechanism of action involves targeting bacterial phosphatases and inhibiting their activity, leading to impaired bacterial growth. With its high specificity and potency, the IGF2BP2 antibody is an invaluable tool for researchers in various fields of study.
Cathepsin D antibody
The Cathepsin D antibody is a highly sensitive detection tool commonly used in immunoassays within the Life Sciences industry. This antibody is designed to specifically target and bind to Cathepsin D, an enzyme involved in various cellular processes. Its ultrasensitive detection capabilities make it ideal for research and diagnostic applications.
MYL3 antibody
MYL3 antibody was raised in Mouse using a purified recombinant fragment of MYL3 expressed in E. coli as the immunogen.
SLC10A5 antibody
SLC10A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids GYSFAKVCTLPLPVCKTVAIESGMLNSFLALAVIQLSFPQSKANLASVAP
ASL antibody
The ASL antibody is a monoclonal antibody that is specifically designed to target and bind to the antigen ASL. This antibody is produced by hybridoma cells, which are created by fusing myeloma cells with B cells that have been immunized with the ASL antigen. The resulting hybridoma cell strain produces large quantities of this specific antibody.
GNB2 antibody
GNB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids CCRFLDDNQIITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAPDGR
SPTLC1 antibody
The SPTLC1 antibody is a highly specialized polyclonal antibody that plays a crucial role in various life science applications. It is designed to target and bind to the SPTLC1 protein, which is involved in the synthesis of sphingolipids, an essential component of cell membranes.
EGFR antibody
The EGFR antibody is a cytotoxic monoclonal antibody that targets the epidermal growth factor receptor (EGFR). It is used as a diagnostic reagent in the field of life sciences to detect and measure the levels of EGFR protein biomarkers. This antibody specifically recognizes and binds to EGFR, inhibiting its activation and downstream signaling pathways. By blocking the interaction between EGFR and its ligands, such as epidermal growth factor, the antibody effectively inhibits cell proliferation and survival. The EGFR antibody has been extensively studied for its potential therapeutic applications in cancer treatment, particularly in tumors that overexpress EGFR. Additionally, this antibody has shown promising results in preclinical studies as a potential nephrotoxic agent due to its ability to inhibit hydroxylase activity. Overall, the EGFR antibody is a valuable tool for researchers and clinicians in studying and targeting EGFR-related diseases.
Purity:Min. 95%TUSC4 antibody
TUSC4 antibody was raised in rabbit using the middle region of TUSC4 as the immunogen
Purity:Min. 95%Caspase 9 antibody
The Caspase 9 antibody is a polyclonal antibody that specifically targets the caspase-9 protein. This antibody has been shown to have neutralizing properties and can effectively inhibit the activity of caspase-9. Caspase-9 plays a crucial role in apoptosis, or programmed cell death, by initiating the cascade of events that lead to cell death. By targeting caspase-9, this antibody can help regulate cell growth and survival.
CCR5 antibody
The CCR5 antibody is a monoclonal antibody that has been widely used in Life Sciences research. It targets the CCR5 receptor, a glycoprotein found on the surface of immune cells. This antibody has been shown to have neutralizing effects on CCR5, blocking its interaction with the ligands and inhibiting viral entry into host cells. It has been used in various immunoassays and hybridoma cell studies to investigate the role of CCR5 in immune response and disease progression. Additionally, this antibody has been utilized for its potential antiviral properties, particularly against HIV-1 strains that use CCR5 as a co-receptor for viral entry. Its specificity and high affinity make it a valuable tool for studying CCR5-related signaling pathways and developing therapeutic strategies targeting this receptor.
Donkey anti Mouse IgG (H + L) (FITC)
Donkey anti-mouse IgG (H + L) (FITC) was raised in donkey using mouse IgG (H&L) as the immunogen.
Purity:Min. 95%IFNAR2 antibody
IFNAR2 antibody was raised in mouse using human interferon alpha/beta receptor chain 1 as the immunogen.
GJB1 antibody
GJB1 antibody was raised using the C terminal of GJB1 corresponding to a region with amino acids GFGHRLSPEYKQNEINKLLSEQDGSLKDILRRSPGTGAGLAEKSDRCSAC
CRP antibody
The CRP antibody is a highly versatile and effective tool for research in the field of immunology. It is designed to specifically target and neutralize C-reactive protein (CRP), a key component of the immune response. This monoclonal antibody has been extensively tested and proven to have high affinity and specificity for CRP.
CFOS antibody
The CFOS antibody is a highly specialized antibody that has antiangiogenic properties. It is commonly used in Life Sciences research to study the formation of new blood vessels and their role in various biological processes. The CFOS antibody works by inhibiting the pro-angiogenic activity of certain proteins, such as epidermal growth factor, that are involved in promoting blood vessel growth. This monoclonal antibody binds specifically to CFOS, a basic protein that plays a key role in regulating cell growth and differentiation. By targeting CFOS, the CFOS antibody can effectively block the formation of new blood vessels and inhibit tumor growth. It is available as both a polyclonal and monoclonal antibody, providing researchers with options for their specific experimental needs. With its high specificity and cytotoxic effects on endothelial cells, the CFOS antibody has proven to be a valuable tool in studying angiogenesis and developing potential anti-cancer therapies.
GFP antibody (biotin)
GFP antibody (biotin) was raised in goat using a GFP fusion protein corresponding to the full length amino acid sequence (246aa) derived from the jellyfish Aequorea victoria as the immunogen.
Caspase 3 antibody
The Caspase 3 antibody is a highly specific monoclonal antibody that targets the caspase 3 protein. Caspase 3 is an important enzyme involved in programmed cell death, also known as apoptosis. This antibody is widely used in life sciences research to study the role of caspase 3 in various cellular processes.
PRMT5 antibody
The PRMT5 antibody is a highly effective inhibitor that specifically targets protein kinase activity. This monoclonal antibody has been extensively tested and validated by Life Sciences experts to ensure its efficacy. It can be used in various applications such as immunoassays, Western blotting, and immunohistochemistry.
DDT antibody
The DDT antibody is a highly specialized monoclonal antibody that targets and binds to DDT (dichlorodiphenyltrichloroethane), a pesticide commonly used in the past. This antibody exhibits high specificity and affinity for DDT, making it an effective tool for research and diagnostic applications.
STIP1 antibody
The STIP1 antibody is a highly specialized monoclonal antibody that targets the glial fibrillary acidic protein (GFAP). It can be used in immunoassays to detect and quantify GFAP in various biological samples. This antibody specifically recognizes the amino group of GFAP, allowing for accurate and sensitive detection. The STIP1 antibody has been extensively validated and is widely used in life sciences research. It is commonly used in studies involving epidermal growth factor (EGF) signaling pathways, as well as in the development of anti-HER2 antibodies. With its high specificity and sensitivity, this antibody offers researchers a valuable tool for studying GFAP-related processes and diseases.
NR2F1 antibody
NR2F1 antibody was raised using the C terminal of NR2F1 corresponding to a region with amino acids VLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQPSRFGKLLLRLP
AS3MT antibody
AS3MT antibody was raised using a synthetic peptide corresponding to a region with amino acids GIKNESHDIVVSNCVINLVPDKQQVLQEAYRVLKHGGELYFSDVYTSLEL
FOXP2 antibody
The FOXP2 antibody is a highly specialized microparticle used in Life Sciences research. It is a polyclonal antibody that specifically targets the FOXP2 protein, which plays a crucial role in various cellular processes. This antibody can be used in applications such as transcription-polymerase chain reaction (PCR), interferon assays, and antigen-antibody reactions.
Purity:Min. 95%P2RX2 antibody
P2RX2 antibody was raised using the N terminal of P2RX2 corresponding to a region with amino acids MAAAQPKYPAGATARRLARGCWSALWDYETPKVIVVRIHRAEKLPGERDG
MDC antibody
MDC antibody was raised in rabbit using highly pure recombinant murine MDC as the immunogen.
Purity:Min. 95%Heparin Binding Protein antibody
The Heparin Binding Protein antibody is a monoclonal antibody used in Life Sciences research. It specifically targets myostatin, a protein involved in muscle growth regulation. This antibody is highly specific and can be used for various applications, including Western blotting, immunohistochemistry, and ELISA assays. The Heparin Binding Protein antibody has been validated for its performance and reliability in detecting myostatin in samples from various species. It can be used to study the role of myostatin in muscle development, regeneration, and diseases such as muscular dystrophy. The antibody has been tested using electrochemical impedance spectroscopy with an electrode coated with heparin-binding protein. It has shown excellent binding affinity and specificity towards the target protein. Furthermore, the Heparin Binding Protein antibody does not cross-react with other chemical agents or cation channels commonly found in biological samples. This makes it a valuable tool for researchers studying myostatin-related pathways and therapeutic interventions.Podoplanin antibody
Podoplanin antibody was raised using the N terminal of PDPN corresponding to a region with amino acids EGASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVAT
Purity:Min. 95%Nestin antibody
The Nestin antibody is a powerful tool for researchers in the field of Life Sciences. This polyclonal antibody specifically targets and binds to Nestin, an intermediate filament protein that is commonly used as a marker for neural stem cells. The antibody has been extensively tested and validated for its specificity and sensitivity in various applications, including immunohistochemistry, western blotting, and flow cytometry.
Goat anti Human Kappa Chain (Fab'2) (FITC)
Goat anti-human kappa chain (Fab'2) (FITC) was raised in goat using human kappa light chain as the immunogen.Purity:Min. 95%PSMA3 antibody
PSMA3 antibody was raised using a synthetic peptide corresponding to a region with amino acids VKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESLKEEDESDDDN
GABAB Receptor antibody
The GABAB Receptor antibody is a protein-based product that has chromatographic characteristics. It is a neutralizing antibody that targets the angptl3 protein, which is involved in various biological processes such as collagen synthesis and growth factor regulation. This monoclonal antibody specifically binds to the GABAB receptor, an important component of the central nervous system. By targeting this receptor, the antibody can modulate neurotransmission and potentially have therapeutic effects in neurological disorders. The GABAB Receptor antibody is activated upon binding to its target and can induce cytotoxic effects on cells expressing the receptor. Additionally, it may interact with other binding proteins such as epidermal growth factor and hepatocyte growth factor, further expanding its potential applications in research and medicine.
PKC gamma antibody
The PKC gamma antibody is a highly effective neutralizing monoclonal antibody that targets the protein kinase C gamma (PKCγ). This antibody acts as a potent family kinase inhibitor, blocking the activity of PKCγ and preventing its role in cell signaling pathways. By inhibiting PKCγ, this antibody has been shown to have anti-VEGF (vascular endothelial growth factor) activity, which can help inhibit the growth of blood vessels and limit angiogenesis. Additionally, it can bind to alpha-fetoprotein (AFP), a tumor marker expressed in certain cancers, and neutralize its effects.
MTRR antibody
MTRR antibody was raised using the N terminal of MTRR corresponding to a region with amino acids YDLKTETAPLVVVVSTTGTGDPPDTARKFVKEIQNQTLPVDFFAHLRYGL
SOX4 antibody
SOX4 antibody was raised in rabbit using the N terminal of SOX4 as the immunogen
Purity:Min. 95%Laminin antibody
Laminin antibody was raised in rabbit using laminin isolated from EHS-mouse sarcoma as the immunogen.Purity:Min. 95%Lgi2 antibody
Lgi2 antibody was raised in rabbit using the middle region of Lgi2 as the immunogen
Purity:Min. 95%PCYT2 antibody
PCYT2 antibody was raised using the C terminal of PCYT2 corresponding to a region with amino acids KVDLVCHGKTEIIPDRDGSDPYQEPKRRGIFRQIDSGSNLTTDLIVQRII
COL1A1 antibody
COL1A1 antibody is a monoclonal antibody that specifically targets the COL1A1 protein. It binds to the apical membrane of cells and can be used for various applications in life sciences research. This antibody has been extensively studied and validated for its specificity and sensitivity. It is commonly used in immunohistochemistry, immunofluorescence, and Western blotting experiments. The COL1A1 antibody can also be used in diagnostic assays to detect the presence of autoantibodies or as a therapeutic agent in pharmaceutical preparations. Additionally, this antibody has shown potential antiviral properties and can inhibit the growth factor signaling pathway, making it a versatile tool for researchers in various fields.
Cytokeratin 20 antibody
Cytokeratin 20 antibody was raised in mouse using electrophoretically purified keratin K20 from human intestinal mucosa as the immunogen.
G6PD antibody
G6PD antibody was raised in mouse using recombinant human G6PD (35-506aa) purified from E. coli as the immunogen.
