Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
Testosterone 3 antibody
Testosterone 3 antibody was raised in rabbit using testosterone-3-oxime albumin as the immunogen.
PLAC1 antibody
PLAC1 antibody was raised in rabbit using placenta specific antigen 1 (PLAC1) as the immunogen.
Purity:Min. 95%FSH antibody
FSH antibody is a growth factor that plays a crucial role in reproductive health. It is a necrosis factor-related apoptosis-inducing protein that regulates follicle development and ovulation. FSH antibody can be used for various applications, such as immunoassays and immunoprecipitation. It is available in both monoclonal and polyclonal forms, allowing researchers to choose the most suitable option for their experiments.
ApoB antibody
ApoB antibody was raised in mouse using human low density lipoprotein as the immunogen.
Bombesin antibody
Bombesin antibody was raised in rabbit using Bombesin-BSA as the immunogen.
Purity:Min. 95%Goat anti Guinea Pig IgG
Goat anti-guinea pig IgG was raised in goat using highly pure normal guinea pig serum as the immunogen.
Purity:Min. 95%HIV1 gp41 antibody (HRP)
HIV1 gp41 antibody (HRP) was raised in mouse using purified, full length Recombinant gp41 (HIV-1) produced in E. coli expression system as the immunogen.
HBsAg antibody
The HBsAg antibody is an activated monoclonal antibody that acts as an inhibitor of natriuretic steroid activity. It is used for various applications in research and diagnostics. This antibody specifically targets the HBsAg protein, which is associated with hepatitis B virus infection. The HBsAg antibody can be conjugated with different labels such as isothiocyanate or phosphatase for detection purposes. It recognizes the glycosylation sites on the HBsAg protein and can be used in assays to detect its presence in biological samples. Additionally, this monoclonal antibody has been used in nuclear medicine studies to visualize specific tissues or cells expressing the targeted antigen. With its high specificity and affinity, the HBsAg antibody offers a valuable tool for researchers and healthcare professionals working in the field of viral infections and diagnostics.cAMP antibody
cAMP antibody was raised in rabbit using succinyl-cAMP-BSA as the immunogen.
Purity:Min. 95%GFP antibody
GFP antibody was raised in Mouse using a purified recombinant fragment of GFP expressed in E. coli as the immunogen.
Elastase antibody
Elastase antibody was raised in rabbit using elastase as the immunogen.
Purity:Min. 95%CRP antibody
CRP antibody was raised in mouse using human CRP derived from pleural/ascetic fluid or plasma as the immunogen.
Testosterone antibody
Testosterone antibody was raised in mouse using testosterone-3-CMO-BSA as the immunogen.
HIV1 p24 antibody (FITC)
HIV1 p24 antibody (FITC) was raised in goat using purified, full length recombinant p24 (HIV-1 IIIB) produced in baculovirus expression system as the immunogen.
Rabbit anti Sheep IgG
Rabbit anti Sheep IgG was raised in rabbit using affinity pure Sheep IgG as the immunogen.
Purity:Min. 95%HIV1 rev antibody (FITC)
HIV1 rev antibody (FITC) was raised in rabbit using full length recombinant rev (HIV-1, HxB2, HxB3) produced in E. coli expression system as the immunogen.
Bimagrumab
CAS:Human monoclonal antibody targeting activin receptor type-2B; treatment of muscle loss and weakness
Phenobarbital antibody
Phenobarbital antibody was raised in goat using phenobarbitol-KLH as the immunogen.
Purity:Min. 95%C-myc antibody
C-myc antibody was raised in chicken using residues 410-419 (EQKLISEEDL) of human myc conjugated to KLH as the immunogen.
Purity:Min. 95%PAP antibody
PAP antibody was raised in rabbit using affinity purified PAP as the immunogen.
Purity:Min. 95%Streptococcus Group A antibody
Streptococcus group A antibody was raised in goat using group A Streptococci as the immunogen.
Purity:Min. 95%Leptin antibody
The Leptin antibody is a monoclonal antibody that specifically targets and neutralizes leptin, a protein hormone involved in regulating energy balance and appetite. This antibody has been extensively studied for its potential therapeutic applications in obesity and metabolic disorders. It binds to leptin with high affinity, preventing its interaction with leptin receptors and inhibiting downstream signaling pathways.Desmoglein 2 antibody
Desmoglein 2 antibody was raised using the N terminal of DSG2 corresponding to a region with amino acids KIHSDLAEERGLKITYKYTGKGITEPPFGIFVFNKDTGELNVTSILDREEPurity:Min. 95%RBP4 antibody
The RBP4 antibody is a chemokine that belongs to the family of antibodies known as Monoclonal Antibodies. It has neutralizing properties and can inhibit the activity of natriuretic peptides, collagen, and TGF-β1. This antibody is widely used in Life Sciences research to study the role of insulin and other signaling pathways. It is a highly specific monoclonal antibody that can be used to detect and quantify RBP4 in various samples. The RBP4 antibody has been shown to have inhibitory properties against protein kinases, making it an important tool for studying cellular signaling and drug development.Measles Virus Nucleoprotein antibody
Measles virus nucleoprotein antibody was raised in goat using full length recombinant measles virus nucleoprotein produced in baculovirus expression system as the immunogen.
Triiodothyronine antibody
Triiodothyronine antibody was raised in rabbit using T3-BSA as the immunogen.
HIV1 gp120 antibody
HIV1 gp120 antibody was raised in rabbit using full length recombinant gp120 (HIV-1) as the immunogen.
Purity:Min. 95%BNP antibody
BNP antibody was raised in mouse using human BNP or synthetic BNP peptide conjugated with carrier protein as the immunogen.Goat anti Rabbit IgG
Goat anti rabbit IgG was raised in goat using highly purified rabbit IgG as the immunogen.
Purity:Min. 95%CD4 (T cell receptor) antibody (FITC)
Mouse monoclonal CD4 (T-cell) antibody (FITC); IgG1; 100 ug per vial; clone 45
Influenza A antibody
The Influenza A antibody is a monoclonal antibody used in the field of life sciences. It is commonly used for research purposes and has various applications in the study of influenza A virus. This antibody specifically targets and binds to antigens associated with the influenza A virus, allowing for the detection and analysis of viral proteins. Monoclonal antibodies like the Influenza A antibody have revolutionized scientific research by providing highly specific tools for studying various biological processes. They are widely used in immunohistochemistry, flow cytometry, and other techniques to identify and characterize specific molecules or cells. The Influenza A antibody can be used in combination with other antibodies or reagents to develop diagnostic tests or therapeutic interventions against influenza A infections. Its high affinity and specificity make it a valuable tool for researchers working on understanding the mechanisms of viral infection, developing vaccines, or testing antiviral drugs. In addition to its applications in virology, this monoclonal antibody has also beenRabbit anti Mouse IgA (biotin)
Rabbit anti-mouse IgA (biotin) was raised in rabbit using murine IgA a chain as the immunogen.
Purity:Min. 95%Goat anti Monkey IgG + IgA + IgM (H + L) (FITC)
Goat anti-monkey IgG/IgA/IgM (H+L) (FITC) was raised in goat using monkey IgG, IgA and IgM whole molecules as the immunogen.
Purity:Min. 95%FABP antibody
FABP antibody was raised in goat using purifed FABP from human heart tissue as the immunogen.
Purity:Min. 95%Estradiol 3 antibody
Estradiol-3 antibody was raised in rabbit using 17 beta Estradiol-3-BSA as the immunogen.
TSH antibody
TSH antibody was raised in goat using human TSH whole molecule as the immunogen.
Purity:Min. 95%hCG antibody
hCG antibody was raised in mouse using hCG affinity pure from pregnancy urine as the immunogen.
HIV1-RT antibody
HIV1-RT antibody was raised in mouse using full length recombinant RT (HIV-1, IIIB) as the immunogen.
CD4 antibody
CD4 antibody was raised in mouse using full length CD4 (T cell receptor) produced in baculovirus expression system as the immunogen.
HSV1 gE antibody
HSV1 gE antibody was raised in mouse using herpes simplex virus I glycoprotein E (gE) as the immunogen.
ApoB antibody
ApoB antibody was raised in mouse using human low density lipoprotein as the immunogen.
PTH antibody (Bovine)
PTH antibody was raised in rabbit using bovine PTH whole molecule as the immunogen.
Goat anti Human IgG
Goat anti Human IgG antibody was raised in goat using human IgG F(c) fragment as the immunogen.
Purity:Min. 95%Luteinizing Hormone antibody
Luteinizing hormone antibody was raised in goat using human pituitary LH as the immunogen.
Progesterone 17-OH antibody
Progesterone antibody was raised in rabbit using 17a-OH progesterone -3-CMO-BSA as the immunogen.
IL6 antibody
The IL6 antibody is a monoclonal antibody that specifically targets interleukin-6 (IL-6), a cytokine involved in various inflammatory processes. This antibody has been designed to neutralize the activity of IL-6, thereby reducing inflammation and its associated symptoms. The IL6 antibody has shown promising results in preclinical studies, demonstrating its potential as a therapeutic option for conditions characterized by excessive IL-6 production, such as autoimmune diseases and certain types of cancer. This antibody is highly specific and does not cross-react with other cytokines or proteins, ensuring targeted and effective treatment. With its unique mechanism of action and high affinity for IL-6, the IL6 antibody holds great promise for improving patient outcomes in a wide range of inflammatory disorders.HIV1 gp120 antibody
HIV1 gp120 antibody was raised in rabbit using full length recombinant gp120 (HIV-1) as the immunogen.
hCG beta antibody
hCG beta antibody was raised in rabbit using HCG beta-KLH as the immunogen.
Purity:Min. 95%Progesterone 3 antibody
Progesterone 3 antibody was raised in rabbit using progesterone 3-CMO-BSA as the immunogen.
Purity:With Sensitivity ToPTH antibody (mid region)
PTH antibody was raised in goat using human PTH as the immunogen.
Purity:Min. 95%HIV1 tat antibody
HIV1 tat antibody was raised in rabbit using purified, full length recombinant TAT (HIV-1) as the immunogen.
Purity:Min. 95%HIV1 p24 antibody (FITC)
HIV1 p24 antibody (FITC) was raised in mouse using purified, full length recombinant p24 (HIV-1) produced in baculovirus expression system as the immunogen.
Human Growth Hormone antibody
human Growth Hormone antibody was raised in rabbit using human growth hormone as the immunogen.
