Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
CD4 antibody
CD4 antibody was raised in mouse using full length recombinant CD4 (T cell) produced in baculovirus expression system as the immunogen.
TSH antibody
TSH antibody was raised in rabbit using human pituitary TSH affinity purified antigen as the immunogen.
Purity:Min. 95%Orosomucoid antibody
Orosomucoid antibody was raised in rabbit using rat alpha-1 acid glycoprotein as the immunogen.
Purity:Min. 95%HIV2 p26 antibody (HRP)
Mouse monoclonal HIV2 p26 antibody (HRP)
Purity:> 95% Purity As Estimated By Analysis Of Sds-Page Gel Prior To Labeling.Triiodothyronine antibody
Triiodothyronine antibody was raised in rabbit using T3-BSA as the immunogen.
Goat anti Rabbit IgG
Goat anti rabbit IgG was raised in goat using highly purified rabbit IgG as the immunogen.
Purity:Min. 95%Morphine 3 antibody
Morphine 3 antibody was raised in goat using 3-carboxymethyl-morphine-BSA as the immunogen.
Purity:Min. 95%Glucagon antibody
Glucagon antibody was raised in rabbit using porcine glucagon-BSA as the immunogen.
Purity:Min. 95%HIV1 tat antibody
HIV1 tat antibody was raised in rabbit using purified, full length recombinant TAT (HIV-1) as the immunogen.
Purity:Min. 95%HIV1 p24 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds with strong bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, thereby inhibiting bacterial growth and preventing transcription and replication. Extensive research has shown its high efficacy on human erythrocytes using a patch-clamp technique.
Purity:Min. 95%Desmoglein 2 antibody
Desmoglein 2 antibody was raised using the N terminal of DSG2 corresponding to a region with amino acids KIHSDLAEERGLKITYKYTGKGITEPPFGIFVFNKDTGELNVTSILDREEPurity:Min. 95%Leptin antibody
The Leptin antibody is a monoclonal antibody used in Life Sciences for various applications. It specifically targets alpha-synuclein, a protein associated with neurodegenerative diseases such as Parkinson's and Alzheimer's. This antibody can be used to study the role of alpha-synuclein in disease progression and develop potential therapeutic interventions.
cAMP antibody
cAMP antibody was raised in rabbit using succinyl-cAMP-BSA as the immunogen.
Purity:Min. 95%Testosterone antibody
Testosterone antibody was raised in mouse using testosterone-3-CMO-BSA as the immunogen.
Streptococcus Group A antibody
Streptococcus group A antibody was raised in goat using group A Streptococci as the immunogen.
Purity:Min. 95%Dilantin antibody
Dilantin antibody was raised in rabbit using phenytoin-BSA as the immunogen.
Purity:Min. 95%Aldosterone 3 antibody
Aldosterone-3 antibody was raised in rabbit using aldosterone-3-BSA as the immunogen.
Purity:Min. 95%EPOr antibody
EPOr antibody was raised in sheep using Erythropoietin (EPO) receptor as the immunogen.
Purity:Min. 95%Goat anti Human IgG
Goat anti Human IgG antibody was raised in goat using human IgG F(c) fragment as the immunogen.
Purity:Min. 95%M-CSF antibody (biotin)
M-CSF antibody (biotin) was raised in rabbit using highly pure recombinant human M-CSF as the immunogen.
Bombesin antibody
Bombesin antibody was raised in rabbit using Bombesin-BSA as the immunogen.
Purity:Min. 95%ApoB antibody
ApoB antibody was raised in goat using apolipoprotein B (hLDL) as the immunogen.
Purity:Min. 95%cAMP antibody
cAMP antibody was raised in rabbit using succinyl-cAMP-BSA as the immunogen.
Purity:Min. 95%CD4 antibody
CD4 antibody was raised in mouse using full length CD4 (T cell receptor) produced in baculovirus expression system as the immunogen.
Phenobarbital antibody
Phenobarbital antibody was raised in goat using phenobarbitol-KLH as the immunogen.
Purity:Min. 95%C-myc antibody
C-myc antibody was raised in chicken using residues 410-419 (EQKLISEEDL) of human myc conjugated to KLH as the immunogen.
Purity:Min. 95%Oportuzumab Monatox
CAS:Antibody-drug conjugate (ADC) a humanized scFv specific for the epithelial cell adhesion molecule, Ep-CAM and a truncated portion of Pseudomonas exotoxin A.
ApoB antibody
ApoB antibody was raised in mouse using human low density lipoprotein as the immunogen.
HIV1 p24 antibody
HIV1 p24 antibody was raised in mouse using full length recombinant p24 (HIV-1) produced in baculovirus expression system as the immunogen.
HIV1 p24 antibody (FITC)
HIV1 p24 antibody (FITC) was raised in mouse using purified, full length recombinant p24 (HIV) produced in baculovirus as the immunogen.
Rabbit anti Mouse IgA (biotin)
Rabbit anti-mouse IgA (biotin) was raised in rabbit using murine IgA a chain as the immunogen.
Purity:Min. 95%Goat anti Monkey IgG + IgA + IgM (H + L) (FITC)
Goat anti-monkey IgG/IgA/IgM (H+L) (FITC) was raised in goat using monkey IgG, IgA and IgM whole molecules as the immunogen.
Purity:Min. 95%M-CSF antibody
M-CSF antibody was raised in rabbit using highly pure recombinant human M-CSF as the immunogen.
Purity:Min. 95%E. coli O157 antibody
E. coli O157 antibody was raised in mouse using the 'O' antigen of E. coli serotype O157 as the immunogen.Sheep anti Rabbit IgG
Sheep anti-rabbit IgG was raised in sheep using highly pure rabbit IgG as the immunogen.
PTH antibody (Bovine)
PTH antibody was raised in rabbit using bovine PTH whole molecule as the immunogen.
Elastase antibody
Elastase antibody was raised in rabbit using elastase as the immunogen.
Purity:Min. 95%HIV1 tat antibody
The HIV1 tat antibody is a highly specialized monoclonal antibody that targets the HIV-1 Tat protein. This protein plays a crucial role in the replication and transmission of the virus. The HIV1 tat antibody has been extensively studied and has shown potent neutralizing activity against the Tat protein, inhibiting its function and preventing viral replication.
CRP antibody
CRP antibody was raised in mouse using human CRP derived from pleural/ascetic fluid or plasma as the immunogen.
AGP antibody
Alpha-1 acid glycoprotein antibody was raised in goat using human alpha-1 acid glycoprotein as the immunogen.
Estradiol 3+6 antibody
Estradiol 3+6 antibody was raised in rabbit using 17 beta-estradiol-6 and 3-BSA as the immunogen.
Purity:Min. 95%Goat anti Rabbit IgG (HRP)
This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.Purity:Min. 95%TSH antibody
TSH antibody was raised in goat using human TSH whole molecule as the immunogen.
Purity:Min. 95%IFN gamma antibody
IFN Gamma antibody was raised in rabbit using highly pure recombinant human IFN-gamma as the immunogen.
Donkey anti Rabbit IgG (H + L) (FITC)
Donkey anti-rabbit IgG (H + L) (FITC) was raised in donkey using rabbit IgG (H&L) as the immunogen.
HIV1-RT antibody
HIV1-RT antibody was raised in rabbit using full length recombinant RT (HIV-1) as the immunogen.
Purity:Min. 95%HIV1 Nef antibody (FITC)
HIV1 Nef antibody (FITC) was raised using purified recombinant nef (HIV-1) produced in E.coli expression system as the immunogen.
HIV1 tat antibody (FITC)
HIV1 tat antibody (FITC) was raised in mouse using purified, full length Recombinant tat (HIV-1) produced in E.coli expression system as the immunogen.
Amphetamine antibody
Amphetamine antibody was raised in goat using amphetamine-ovalbumin as the immunogen.
Purity:Min. 95%Helicobacter pylori antibody
Helicobacter pylori antibody is a molecular docking protein used in Life Sciences. It specifically targets the Helicobacter bacteria, which is known to cause various gastrointestinal diseases. This antibody has been extensively studied and proven to have a high affinity for H. pylori antigens, making it an effective tool for research and diagnostic purposes. Additionally, it has been shown to inhibit the chemokine production by H. pylori, thereby reducing inflammation caused by the bacteria. The antibody can be immobilized on surfaces such as ferritin or glycopeptide for use in assays or diagnostic tests. Monoclonal Antibodies with specific glycosylation patterns are available, allowing researchers to target different epitopes of the bacteria. Furthermore, this antibody has shown potential as a therapeutic agent against H. pylori infections by inhibiting its growth factor TGF-beta and phosphatase activity. Overall, Helicobacter pylori antibody is a valuable tool in the fight against H. pylori-related diseases
HIV1 p24 antibody (biotin)
HIV1 p24 antibody (biotin) was raised in rabbit using full length recombinant p24 (HIV-1) produced in baculovirus expression system as the immunogen.
HIV1 gp120 antibody
HIV1 gp120 antibody was raised in rabbit using full length recombinant gp120 (HIV-1) as the immunogen.
Purity:Min. 95%Osteocalcin antibody
The Osteocalcin antibody is a highly specialized monoclonal antibody that targets and neutralizes the activity of osteocalcin. Osteocalcin is a protein involved in bone formation and remodeling. This antibody specifically binds to osteocalcin, preventing its activation and inhibiting its function.Prolactin antibody
The Prolactin antibody is a highly specialized monoclonal antibody used in Life Sciences research. It has the unique ability to neutralize the activity of prolactin, a hormone involved in various physiological processes such as lactation, reproduction, and immune regulation. This antibody specifically targets and binds to prolactin receptors, preventing the hormone from binding and initiating downstream signaling pathways.
Purity:Min. 95%HIV1 p24 antibody
HIV1 p24 antibody was raised in sheep using purified full length recombinant p24 as the immunogen.
Purity:Min. 95%
