Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,542 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75447 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Aurora A antibody
The Aurora A antibody is a highly effective monoclonal antibody that is used for various applications in research and diagnostics. This antibody specifically targets and neutralizes the Aurora A kinase, which plays a crucial role in cell division and mitosis. By inhibiting the activity of Aurora A, this antibody can effectively block cell division and proliferation.Purity:Min. 95%DNAJC25 antibody
DNAJC25 antibody was raised using a synthetic peptide corresponding to a region with amino acids RDEEENIIKNIIKSKIDIKGGYQKPQICDLLLFQIILAPFHLCSYIVWYCPurity:Min. 95%RNASEH2A antibody
RNASEH2A antibody was raised using the C terminal of RNASEH2A corresponding to a region with amino acids EKEAEDVIWEDSASENQEGLRKITSYFLNEGSQARPRSSHRYFLERGLESPurity:Min. 95%LRP8 antibody
LRP8 antibody was raised using the middle region of LRP8 corresponding to a region with amino acids ATVDGGRRRTLFSRNLSEPRAIAVDPLRGFMYWSDWGDQAKIEKSGLNGV
Purity:Min. 95%RTN1 antibody
RTN1 antibody was raised using the middle region of RTN1 corresponding to a region with amino acids MAVVSMFTLPVVYVKHQAQIDQYLGLVRTHINAVVAKIQAKIPGAKRHAEPurity:Min. 95%alpha 1 Antitrypsin antibody (Prediluted for IHC)
Rabbit polyclonal alpha 1 Antitrypsin antibody (Prediluted for IHC)Purity:Min. 95%Kidins220 antibody
Kidins220 antibody was raised in rabbit using residues 1747-1762 [ASSESTGFGEERESIL] of the human 220kDa Kidins220 protein as the immunogen.Purity:Min. 95%IKZF2 antibody
IKZF2 antibody was raised in rabbit using the middle region of IKZF2 as the immunogen
Purity:Min. 95%PLCD1 antibody
PLCD1 antibody was raised using the N terminal of PLCD1 corresponding to a region with amino acids HWIHSCLRKADKNKDNKMSFKELQNFLKELNIQVDDSYARKIFRECDHSQ
Purity:Min. 95%FAM79B antibody
FAM79B antibody was raised in rabbit using the C terminal of FAM79B as the immunogenPurity:Min. 95%Leptin antibody
Leptin antibody was raised in rabbit using highly pure recombinant human leptin as the immunogen.Purity:Min. 95%TMEM115 antibody
TMEM115 antibody was raised using the N terminal of TMEM115 corresponding to a region with amino acids LLSFAVDTGCLAVTPGYLFPPNFWIWTLATHGLMEQHVWDVAISLTTVVVPurity:Min. 95%TCEAL2 antibody
TCEAL2 antibody was raised in rabbit using the N terminal of TCEAL2 as the immunogenPurity:Min. 95%GPR27 antibody
GPR27 antibody was raised using the middle region of GPR27 corresponding to a region with amino acids LVCAAWALALAAAFPPVLDGGGDDEDAPCALEQRPDGAPGALGFLLLLAVPurity:Min. 95%CLCA2 antibody
CLCA2 antibody was raised in rabbit using the C terminal of CLCA2 as the immunogenPurity:Min. 95%FURIN antibody
FURIN antibody was raised using a synthetic peptide corresponding to a region with amino acids RDVYQEPTDPKFPQQWYLSGVTQRDLNVKAAWAQGYTGHGIVVSILDDGIPurity:Min. 95%DKC1 antibody
DKC1 antibody was raised using the N terminal of DKC1 corresponding to a region with amino acids EFLIKPESKVAKLDTSQWPLLLKNFDKLNVRTTHYTPLACGSNPLKREIG
Purity:Min. 95%CDKL3 antibody
CDKL3 antibody is a monoclonal antibody that targets the CDKL3 protein, which is involved in various growth factor signaling pathways. It has been extensively studied in the field of Life Sciences and has shown promising results. The CDKL3 antibody specifically binds to the amino-terminal region of the CDKL3 protein and inhibits its activity.Purity:Min. 95%NDST4 antibody
NDST4 antibody was raised using a synthetic peptide corresponding to a region with amino acids YLFLLMHPSIISNLPSPKTFEEVQFFNGNNYHKGIDWYMDFFPTPSNTTSPurity:Min. 95%ZNF529 antibody
ZNF529 antibody was raised in rabbit using the N terminal of ZNF529 as the immunogen
Purity:Min. 95%RIPX antibody
RIPX antibody was raised in rabbit using the C terminal of RIPX as the immunogenPurity:Min. 95%TSTA3 antibody
TSTA3 antibody was raised using the N terminal of TSTA3 corresponding to a region with amino acids MGEPQGSMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTDPurity:Min. 95%Collagen Type XI α 2 antibody
Collagen Type XI Alpha 2 antibody was raised using the N terminal of COL11A2 corresponding to a region with amino acids TADRFQAEEYGEGGTDPPEGPYDYTYGYGDDYREETELGPALSAETAHSGPurity:Min. 95%PTX3 antibody
PTX3 antibody was raised in rabbit using the N terminal of PTX3 as the immunogenPurity:Min. 95%LOC391766 antibody
LOC391766 antibody was raised in rabbit using the middle region of LOC391766 as the immunogenPurity:Min. 95%FCRLA antibody
FCRLA antibody was raised using the middle region of FCRLA corresponding to a region with amino acids PTLNPAPQKSAAPGTAPEEAPGPLPPPPTPSSEDPGFSSPLGMPDPHLYHPurity:Min. 95%SKAP1 antibody
SKAP1 antibody was raised using the N terminal of SKAP1 corresponding to a region with amino acids RDHILRGFQQIKARYYWDFQPQGGDIGQDSSDDNHSGTLGLSLTSDAPFLPurity:Min. 95%SEC63 antibody
SEC63 antibody was raised using a synthetic peptide corresponding to a region with amino acids WPRDQNAEQIRLKNIRKVYGRCMWYRLRLLKPQPNIIPTVKKIVLLAGWAPurity:Min. 95%CFP antibody
CFP antibody was raised using the middle region of CFP corresponding to a region with amino acids SMVEGQGEKNVTFWGRPLPRCEELQGQKLVVEEKRPCLHVPACKDPEEEEPurity:Min. 95%MARS antibody
MARS antibody was raised in rabbit using the middle region of MARS as the immunogenPurity:Min. 95%C11ORF24 antibody
C11ORF24 antibody was raised using the N terminal Of C11Orf24 corresponding to a region with amino acids SPVTLTKGTSAAHLNSMEVTTEDTSRTDVSEPATSGGAADGVTSIAPTAVPurity:Min. 95%NTRK3 antibody
NTRK3 antibody was raised using the C terminal of NTRK3 corresponding to a region with amino acids ERPRVCPKEVYDVMLGCWQREPQQRLNIKEIYKILHALGKATPIYLDILGPurity:Min. 95%SOX17 antibody
SOX17 antibody was raised in rabbit using the middle region of SOX17 as the immunogenPurity:Min. 95%CD7 antibody
CD7 antibody was raised in rabbit using the middle region of CD7 as the immunogen
Purity:Min. 95%SNAP29 antibody
SNAP29 antibody was raised in rabbit using the middle region of SNAP29 as the immunogenPurity:Min. 95%CASP10 antibody
CASP10 antibody was raised in rabbit using the middle region of CASP10 as the immunogenPurity:Min. 95%Cytokeratin AE3 antibody (Prediluted for IHC)
Mouse monoclonal Cytokeratin AE3 antibody (Prediluted for IHC)Purity:Min. 95%TCEAL3 antibody
TCEAL3 antibody was raised in rabbit using the N terminal of TCEAL3 as the immunogenPurity:Min. 95%Ttbk2 antibody
Ttbk2 antibody was raised in rabbit using the N terminal of Ttbk2 as the immunogenPurity:Min. 95%DFFB antibody
DFFB antibody was raised using a synthetic peptide corresponding to a region with amino acids EYFYGLLFTSENLKLVHIVCHKKTTHKLNCDPSRIYKPQTRLKRKQPVRKPurity:Min. 95%ANP32A antibody
ANP32A antibody was raised using a synthetic peptide corresponding to a region with amino acids FNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDE
Purity:Min. 95%SIL1 antibody
SIL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLQQYRQVHLLPGLWEQGWCEITAHLLALPEHDAREKVLQTLGVLLTTCRPurity:Min. 95%Rabbit λ light chain antibody (Prediluted for IHC)
Rabbit polyclonal Lambda light chain antibody (Prediluted for IHC)Purity:Min. 95%LPCAT1 antibody
LPCAT1 antibody was raised using the middle region of LPCAT1 corresponding to a region with amino acids LRLPADTCLLEFARLVRGLGLKPEKLEKDLDRYSERARMKGGEKIGIAEFPurity:Min. 95%GCNT4 antibody
GCNT4 antibody was raised using a synthetic peptide corresponding to a region with amino acids SKDTYSPDEHFWATLIRVPGIPGEISRSAQDVSDLQSKTRLVKWNYYEGFPurity:Min. 95%Pde4d antibody
Pde4d antibody was raised in rabbit using the N terminal of Pde4d as the immunogenPurity:Min. 95%Annexin A8-Like 2 antibody
Annexin A8-Like 2 antibody was raised using the N terminal of ANXA8L2 corresponding to a region with amino acids PDAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQIAKSFKAQFGKDLTETPurity:Min. 95%NUP155 antibody
NUP155 antibody was raised in rabbit using the N terminal of NUP155 as the immunogenPurity:Min. 95%OR2T1 antibody
OR2T1 antibody was raised in rabbit using the C terminal of OR2T1 as the immunogenPurity:Min. 95%FKBP8 antibody
FKBP8 antibody was raised using the C terminal of FKBP8 corresponding to a region with amino acids AIPILRAALKLEPSNKTIHAELSKLVKKHAAQRSTETALYRKMLGNPSRLPurity:Min. 95%ZNF548 antibody
ZNF548 antibody was raised in rabbit using the N terminal of ZNF548 as the immunogen
Purity:Min. 95%KCND3 antibody
KCND3 antibody was raised using the middle region of KCND3 corresponding to a region with amino acids VAKTGSSNAYLHSKRNGLLNEALELTGTPEEEHMGKTTSLIESQHHHLLHPurity:Min. 95%PDHA2 antibody
PDHA2 antibody was raised in rabbit using the N terminal of PDHA2 as the immunogenPurity:Min. 95%PBK antibody
PBK antibody was raised using the N terminal of PBK corresponding to a region with amino acids SLCLAMEYGGEKSLNDLIEERYKASQDPFPAAIILKVALNMARGLKYLHQPurity:Min. 95%MFAP4 antibody
MFAP4 antibody was raised using the N terminal of MFAP4 corresponding to a region with amino acids TEGGKWTVFQKRFNGSVSFFRGWNDYKLGFGRADGEYWLGLQNMHLLTLKPurity:Min. 95%LGALS9 antibody
LGALS9 antibody was raised using a synthetic peptide corresponding to a region with amino acids YPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHPurity:Min. 95%ZNF90 antibody
ZNF90 antibody was raised in rabbit using the N terminal of ZNF90 as the immunogen
Purity:Min. 95%Exodus 2 antibody
Exodus 2 antibody was raised in rabbit using highly pure recombinant human exodus-2 as the immunogen.Purity:Min. 95%CD8A antibody
CD8A antibody was raised in rabbit using the middle region of CD8A as the immunogenPurity:Min. 95%RSV antibody
RSV antibody was raised in rabbit using whole RSV virions (subgroup A-Long strain) as the immunogen.Purity:Min. 95%Dtx3 antibody
Dtx3 antibody was raised in rabbit using the C terminal of Dtx3 as the immunogenPurity:Min. 95%SLC25A19 antibody
SLC25A19 antibody was raised in rabbit using the middle region of SLC25A19 as the immunogenPurity:Min. 95%UNCX antibody
UNCX antibody was raised in rabbit using the N terminal of UNCX as the immunogenPurity:Min. 95%GRHL3 antibody
GRHL3 antibody was raised in rabbit using the C terminal of GRHL3 as the immunogenPurity:Min. 95%Abo antibody
Abo antibody was raised in rabbit using the middle region of Abo as the immunogenPurity:Min. 95%CLEC4G antibody
CLEC4G antibody was raised using the N terminal of CLEC4G corresponding to a region with amino acids RTNASKQTAALGALKEEVGDCHSCCSGTQAQLQTTRAELGEAQAKLMEQEPurity:Min. 95%FGF9 antibody
FGF9 antibody was raised in rabbit using highly pure recombinant murine FGF-9 as the immunogen.Purity:Min. 95%CYP2A7 antibody
CYP2A7 antibody was raised using the middle region of CYP2A7 corresponding to a region with amino acids KVEHNQRTLDPNSPQDFIDSFLIHMQEEEKNPNTEFYLKNLMMSTLNLFIPurity:Min. 95%SCF antibody
SCF antibody was raised in goat using highly pure recombinant human SCF as the immunogen.Purity:Min. 95%ZCCHC3 antibody
ZCCHC3 antibody was raised in rabbit using the middle region of ZCCHC3 as the immunogenPurity:Min. 95%C1QB antibody
C1QB antibody was raised using the C terminal of C1QB corresponding to a region with amino acids AYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPDPurity:Min. 95%Cardiotrophin 1 antibody
Cardiotrophin 1 antibody was raised in rabbit using highly purerecombinant hCT-1 (human Cardiotrophin-1) as the immunogen.Purity:Min. 95%IL13 antibody
IL13 antibody was raised in rabbit using highly pure recombinant murine IL-13 as the immunogen.
Purity:Min. 95%Epor antibody
Epor antibody was raised in rabbit using the N terminal of Epor as the immunogen
Purity:Min. 95%MCTS1 antibody
MCTS1 antibody was raised using the N terminal of MCTS1 corresponding to a region with amino acids MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVPurity:Min. 95%GALNT4 antibody
GALNT4 antibody was raised using a synthetic peptide corresponding to a region with amino acids VGHVFPKRAPYARPNFLQNTARAAEVWMDEYKEHFYNRNPPARKEAYGDIPurity:Min. 95%SLC17A3 antibody
SLC17A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids FVVIYDDPVSYPWISTSEKEYIISSLKQQVGSSKQPLPIKAMLRSLPIWSPurity:Min. 95%ZNF280A antibody
ZNF280A antibody was raised in rabbit using the C terminal of ZNF280A as the immunogenPurity:Min. 95%CHRND antibody
CHRND antibody was raised in rabbit using the N terminal of CHRND as the immunogen
Purity:Min. 95%CRISP1 antibody
CRISP1 antibody was raised using the N terminal of CRISP1 corresponding to a region with amino acids LKMSWSEEAAQNARIFSKYCDMTESNPLERRLPNTFCGENMHMTSYPVSWPurity:Min. 95%RHEB antibody
RHEB antibody was raised using the middle region of RHEB corresponding to a region with amino acids VGKVQIPIMLVGNKKDLHMERVISYEEGKALAESWNAAFLESSAKENQTA
Purity:Min. 95%WNT6 antibody
WNT6 antibody was raised using the middle region of WNT6 corresponding to a region with amino acids ERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRTG
Purity:Min. 95%OR2W1 antibody
OR2W1 antibody was raised in rabbit using the C terminal of OR2W1 as the immunogen
Purity:Min. 95%Tmem132d antibody
Tmem132d antibody was raised in rabbit using the middle region of Tmem132d as the immunogen
Purity:Min. 95%Integrin Beta 8 antibody
Integrin Beta 8 antibody was raised using the C terminal of ITGB8 corresponding to a region with amino acids CTDPRSIGRFCEHCPTCYTACKENWNCMQCLHPHNLSQAILDQCKTSCAL
Purity:Min. 95%TOP2B antibody
TOP2B antibody was raised in rabbit using the middle region of TOP2B as the immunogenPurity:Min. 95%Gpr88 antibody
Gpr88 antibody was raised in rabbit using the C terminal of Gpr88 as the immunogenPurity:Min. 95%E2F8 antibody
E2F8 antibody was raised in rabbit using the middle region of E2F8 as the immunogenPurity:Min. 95%LONRF2 antibody
LONRF2 antibody was raised using the middle region of LONRF2 corresponding to a region with amino acids IGISRFRVLSHRHRDGYNTADIEYLEDEKVEGPEYEELAALHDSVHQQSVPurity:Min. 95%TUT1 antibody
TUT1 antibody was raised in rabbit using the N terminal of TUT1 as the immunogenPurity:Min. 95%MAPK6 antibody
MAPK6 antibody was raised in rabbit using the middle region of MAPK6 as the immunogen
Purity:Min. 95%CYP20A1 antibody
CYP20A1 antibody was raised using the N terminal of CYP20A1 corresponding to a region with amino acids ITPTEEKDGNLPDIVNSGSLHEFLVNLHERYGPVVSFWFGRRLVVSLGTVPurity:Min. 95%SMYD5 antibody
SMYD5 antibody was raised in rabbit using the C terminal of SMYD5 as the immunogenPurity:Min. 95%
