Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
Helicobacter pylori antibody
Helicobacter pylori antibody was raised in mouse using purified H. pylori antigen as the immunogen.HS3ST6 antibody
HS3ST6 antibody was raised using a synthetic peptide corresponding to a region with amino acids GERLVSDPAGEVGRVQDFLGLKRVVTDKHFYFNATKGFPCLKKAQGGSRP
OAT antibody
OAT antibody was raised in mouse using recombinant human OAT (33-439aa) purified from E.coli as the immunogen.
Goat anti Human IgG
Goat anti-human IgG was raised in goat using human IgG F(c) fragment as the immunogen.
Purity:Min. 95%JAK2 antibody
The JAK2 antibody is a highly specific monoclonal antibody that targets the Janus kinase 2 (JAK2) protein. This antibody is produced by hybridoma cells, which are created by fusing mouse myeloma cells with spleen cells from immunized mice. The resulting hybridoma cell line secretes the JAK2 antibody, which can be purified and used for various applications in life sciences research.
SIVA1 antibody
The SIVA1 antibody is a highly specific monoclonal antibody that targets the biomolecule SIVA1. It is derived from isolated nucleic acids and collagen, making it a powerful tool for research in the field of Life Sciences. The SIVA1 antibody has been developed using cell hybridomas and chromatographic techniques to ensure high purity and specificity. It binds to hyaluronan receptors on the cell-extracellular matrix interface, allowing for precise detection and analysis of SIVA1 in various biological samples. This specific antibody can be used in applications such as immunohistochemistry, Western blotting, and ELISA assays to study the function and expression of SIVA1 in different cellular contexts. With its exceptional sensitivity and selectivity, the SIVA1 antibody is an invaluable asset for scientists seeking to unravel the complexities of cellular signaling pathways and protein interactions.
HADHB antibody
6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is particularly effective in treating tuberculosis infections, thanks to its bactericidal activity. This compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its efficacy has been demonstrated through experiments using the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.
Mouse anti Rat IgG2a (HRP)
IgG2a antibody was raised in Mouse using Rat IgG2a as the immunogen.Purity:Min. 95%ATP6V1B2 antibody
ATP6V1B2 antibody was raised using the middle region of ATP6V1B2 corresponding to a region with amino acids NFIAQGPYENRTVFETLDIGWQLLRIFPKEMLKRIPQSTLSEFYPRDSAK
PFKFB3 antibody
The PFKFB3 antibody is a highly specialized tool used in the field of Life Sciences. It belongs to the category of Polyclonal Antibodies and is designed to target and bind to specific proteins associated with PFKFB3. This antibody can be used in various applications such as solid phase assays, histidine quantitation, and messenger RNA analysis.
ZNF326 antibody
ZNF326 antibody was raised in rabbit using the C terminal of ZNF326 as the immunogen
Purity:Min. 95%BDNF antibody
The BDNF antibody is a neuroprotective agent that acts as a family kinase inhibitor. It targets the adiponectin receptor, which is involved in various cellular processes related to adipose tissue. This antibody is commonly used in life sciences research and is available as both polyclonal and monoclonal antibodies.
Fibronectin 1 antibody
Fibronectin 1 antibody was raised using the N terminal of FN1 corresponding to a region with amino acids GNALVCTCYGGSRGFNCESKPEAEETCFDKYTGNTYRVGDTYERPKDSMIPurity:Min. 95%SLC7A11 antibody
SLC7A11 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Purity:Min. 95%SITPEC antibody
SITPEC antibody was raised in rabbit using the middle region of SITPEC as the immunogen
Purity:Min. 95%SEMA3D antibody
SEMA3D antibody was raised using the middle region of SEMA3D corresponding to a region with amino acids LECIPKSQQATIKWYIQRSGDEHREELKPDERIIKTEYGLLIRSLQKKDS
Purity:Min. 95%Donkey anti Mouse IgG (H + L) (FITC)
This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.
Purity:Min. 95%Pirimiphos antibody
Pirimiphos antibody is a highly specialized antibody used in the field of Life Sciences. It belongs to the category of polyclonal antibodies and is commonly used for research purposes. This antibody specifically targets insulin, a hormone that plays a crucial role in regulating blood sugar levels. By binding to insulin, Pirimiphos antibody can be used to study insulin signaling pathways and its involvement in various physiological processes.
ZNF548 antibody
ZNF548 antibody was raised in rabbit using the N terminal of ZNF548 as the immunogen
Purity:Min. 95%SYCP1 antibody
SYCP1 antibody was raised using the N terminal of SYCP1 corresponding to a region with amino acids NFLPVLEQVGNSDCHYQEGLKDSDLENSEGLSRVYSKLYKEAEKIKKWKV
Purity:Min. 95%Mouse Thymocyte antibody
Mouse thymocyte antibody was raised in rabbit using RBC-free murine thymocytes as the immunogen.
EMP2 antibody
EMP2 antibody was raised using the middle region of EMP2 corresponding to a region with amino acids IQLMSCLCVMIAASIYTDRREDIHDKNAKFYPVTREGSYGYSYILAWVAF
FAM54A antibody
FAM54A antibody was raised using the middle region of FAM54A corresponding to a region with amino acids NKTNYSHHSKSQRNKDIPNMLDVLKDMNKVKLRAIERSPGGRPIHKRKRQ
LGI4 antibody
LGI4 antibody was raised in Rat using Mouse Lgi4 peptide coupled to carrier protein as the immunogen.CYP2A6 antibody
The CYP2A6 antibody is a highly specialized monoclonal antibody that is widely used in clinical research and diagnostics. It is specifically designed to detect the presence of CYP2A6, an important protein kinase involved in various cellular processes. This antibody has proven to be highly effective in immunohistochemistry studies, allowing for the precise localization and quantification of CYP2A6 expression in tissues and cells. Its high specificity ensures accurate detection, making it an invaluable tool for researchers working in the field of oncology, as well as other areas of life sciences. With its exceptional performance and reliability, the CYP2A6 antibody is a must-have for any laboratory or research facility conducting studies related to protein expression and function.
ZHX2 antibody
ZHX2 antibody was raised in rabbit using the C terminal of ZHX2 as the immunogen
Purity:Min. 95%Goat anti Mouse IgM (Fab'2) (HRP)
Goat anti-mouse IgM (Fab'2) (HRP) was raised in goat using murine IgM mu heavy chain as the immunogen.Purity:Min. 95%Florfenicol Amine antibody
Florfenicol Amine antibody is a powerful tool for detecting and studying the expression of forskolin in various samples. It is a polyclonal antibody that specifically binds to forskolin, a potent activator of adenylate cyclase. This antibody can be used in various applications, including Western blotting, immunohistochemistry, and ELISA.Purity:Min. 95%PDIA4 antibody
The PDIA4 antibody is a highly specialized product in the field of Life Sciences. It possesses unique characteristics that make it a valuable tool for various applications. This monoclonal antibody has been developed to target and neutralize the activity of PDIA4, a protein kinase involved in important cellular processes.
STUB1 antibody
STUB1 antibody was raised using the N terminal of STUB1 corresponding to a region with amino acids MKGKEEKEGGARLGAGGGSPEKSPSAQELKEQGNRLFVGRKYPEAAACYG
CD8a antibody (CY5)
CD8a antibody (CY5) was raised in mouse using trhe alpha chain of chicken CD8 as the immunogen.
Purity:Min. 95%RAGE antibody
The RAGE antibody is a monoclonal antibody that specifically targets the receptor for advanced glycation end products (RAGE). It is derived from human serum albumin and has been shown to have neutralizing properties against various growth factors, chemokines, and epidermal growth factor-like molecules. The RAGE antibody works by inhibiting the binding of these molecules to RAGE, thereby preventing their downstream signaling pathways. This antibody can be used in various life science research applications, such as immunohistochemistry, Western blotting, and flow cytometry. Additionally, polyclonal antibodies are also available for those who require a broader range of target recognition. With its high specificity and inhibitory effects, the RAGE antibody is a valuable tool for studying the role of RAGE in various biological processes.
Goat anti Human IgG (rhodamine)
This antibody reacts with heavy chains on human IgG (gamma chain).
Purity:Min. 95%Goat anti Human IgG (Fab'2) (HRP)
Goat anti-human IgG (Fab'2) (HRP) was raised in goat using human IgG F(ab’)2 fragment as the immunogen.Purity:Min. 95%Monensin antibody
The Monensin antibody is a highly specialized antibody used in Life Sciences research. It is an acidic polyclonal antibody that specifically targets and binds to Monensin, a compound known for its cytotoxic and inhibitory effects on various cellular processes. This antibody has been extensively studied and validated for its specificity and sensitivity in detecting Monensin in biological samples.Purity:Min. 95%FGF2 antibody
FGF2 antibody was raised using a synthetic peptide corresponding to a region with amino acids RLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
ZNF683 antibody
ZNF683 antibody was raised in rabbit using the N terminal of ZNF683 as the immunogenPurity:Min. 95%mGluR1 alpha antibody
mGluR1 alpha antibody was raised in rabbit using a synthetic peptide comprising internal residues of the human GluR1 alpha protein as the immunogen.Purity:Min. 95%ATG5 antibody
ATG5 antibody was raised using a synthetic peptide corresponding to a region with amino acids DPEDGEKKNQVMIHGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTDPurity:Min. 95%Chromogranin A antibody
Chromogranin A antibody was raised in mouse using human pheochromocytoma as the immunogen.
CORO1A antibody
The CORO1A antibody is a highly specialized monoclonal antibody that is activated and designed to target a specific antigen. It is commonly used in the field of Life Sciences for various research purposes. This multispecific antibody is known for its high affinity towards its target and can be used in a variety of applications, including immunohistochemistry, Western blotting, and flow cytometry.p63 antibody
The p63 antibody is a monoclonal antibody that specifically targets the p63 protein. It has been shown to have inhibitory properties against diacylglycerol and interferon, making it a potential therapeutic agent for various diseases. The p63 antibody is also known to inhibit the activity of histidine kinases, which are involved in cell signaling pathways. Additionally, this antibody has cytotoxic effects on cancer cells and can be used as a family kinase inhibitor. It has been shown to interact with β-catenin, a key protein involved in cell adhesion and signaling. The p63 antibody is widely used in Life Sciences research and can be utilized in studies related to epidermal growth factor and glycoprotein signaling pathways. Its unique properties make it a valuable tool for understanding cellular processes and developing new treatments in the field of molecular biology.
KCTD11 antibody
KCTD11 antibody was raised using the N terminal of KCTD11 corresponding to a region with amino acids RLGRLDLPRGYGETALLRAEADFYQIRPLLDALRELEASQGTPAPTAALL
Estrogen Receptor antibody
Estrogen Receptor antibody was raised in Mouse using a purified recombinant fragment of ESR1(aa301-595) expressed in E. coli as the immunogen.
HEY1 antibody
HEY1 antibody was raised using the N terminal of HEY1 corresponding to a region with amino acids ALGSMSPTTSSQILARKRRRGIIEKRRRDRINNSLSELRRLVPSAFEKQG
Purity:Min. 95%LOC400856 antibody
LOC400856 antibody was raised using the C terminal of LOC400856 corresponding to a region with amino acids SLHTSPRAEGAGSGLSQPQRRALTAQGGAEGLLERGQSGHGGRGGAKSER
QSOX1 antibody
The QSOX1 antibody is a powerful tool in the field of life sciences. It is a polyclonal antibody that can neutralize the activity of QSOX1, an enzyme involved in the formation of disulfide bonds in proteins. This antibody recognizes a conformational epitope on QSOX1 and inhibits its function as a topoisomerase inhibitor.
EPHA3 antibody
The EPHA3 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It targets the fatty acid receptor EPHA3, which plays a crucial role in various cellular processes such as cell growth and differentiation. This antibody has been extensively studied and validated for its ability to specifically bind to EPHA3, making it an essential tool for researchers working in this area.
RNF39 antibody
RNF39 antibody was raised using the N terminal of RNF39 corresponding to a region with amino acids EGRKAAKVNAGVGEKGIYTASSRGGPPSARSKAVTVVAEGAASRSWLSMD
Donkey anti Mouse IgG (H + L) (FITC)
This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.
Purity:Min. 95%AKR1B1 antibody
The AKR1B1 antibody is a glycoprotein that targets a specific human protein. It is widely used in the field of Life Sciences for its antiviral properties. This antibody is commonly used in immunoassays, where it plays a crucial role in detecting and quantifying the presence of the target protein. The AKR1B1 antibody can also be used as a tool in various research applications, such as studying fatty acid metabolism or investigating the role of progesterone in cellular processes. It is available as both polyclonal and monoclonal antibodies, providing researchers with options to suit their specific needs. The AKR1B1 antibody has been extensively tested and validated, ensuring reliable and accurate results in experiments. Whether you are conducting basic research or developing diagnostic assays, this antibody is an essential tool for your scientific endeavors.
ZDHHC17 antibody
ZDHHC17 antibody was raised using the middle region of ZDHHC17 corresponding to a region with amino acids FLVIWLVGFIADLNIDSWLIKGLMYGGVWATVQFLSKSFFDHSMHSALPL
VIM antibody
The VIM antibody is a monoclonal antibody that targets the interleukin-6 (IL-6) chemokine. It specifically binds to galectin-3-binding protein (LGALS3BP), which plays a crucial role in various biological processes, including cell growth and proliferation. The VIM antibody can be used in research applications to study protein-protein interactions and investigate the function of LGALS3BP in different cellular pathways.
Androgen Receptor antibody
The Androgen Receptor antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody specifically designed to target the androgen receptor, a steroid receptor protein that plays a crucial role in mediating the effects of androgens in various biological processes. This antibody can be used for a wide range of applications, including immunoassays, neutralizing experiments, and as a probe for detecting the presence of the androgen receptor.
Goat anti mouse IgG1
Mouse IgG1 antibody was raised in goat using mouse IgG1 in freunds adjuvant as the immunogen.Purity:Min. 95%C1 inhibitor antibody
The C1 inhibitor antibody is a powerful tool used in Life Sciences research. This antibody specifically targets and binds to the C1 inhibitor protein, which plays a crucial role in regulating the complement system. Autoantibodies against the C1 inhibitor can lead to various autoimmune diseases, making this antibody an essential tool for studying these conditions.
PLVAP antibody
The PLVAP antibody is a glycopeptide that belongs to the class of antibodies used in Life Sciences. It is specifically designed to target and bind to PLVAP (Plasmalemma Vesicle-Associated Protein), an important protein involved in various biological processes. This antibody is available in both polyclonal and monoclonal forms, providing researchers with options for their specific experimental needs.
Ibuprofen antibody
The Ibuprofen antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and bind specifically to Ibuprofen, a nonsteroidal anti-inflammatory drug commonly used for pain relief and reducing inflammation. This antibody can be used in various assays, including nuclear and GAPDH assays, to detect the presence and levels of Ibuprofen in samples.
STEAP1 antibody
The STEAP1 antibody is a highly specialized antibody that targets the phosphatase STEAP1. This antibody has cytotoxic properties and has been shown to disrupt actin filaments, leading to cell death. It is available as both polyclonal and monoclonal antibodies, offering researchers a range of options for their experiments. In the field of Life Sciences, this antibody is widely used for its neutralizing effects on STEAP1 activity. The monoclonal antibody variant has been specifically designed to be activated upon binding to STEAP1, ensuring optimal performance in immunoassays. With its high affinity and specificity, this antibody can be used in various applications such as Western blotting, immunofluorescence, and flow cytometry. Researchers can rely on the STEAP1 antibody to accurately detect and measure the levels of this important glycoprotein in their experiments.
HTR1A antibody
HTR1A antibody was raised in rabbit using the N terminal of HTR1A as the immunogen
Purity:Min. 95%Amphiphysin antibody
The Amphiphysin antibody is a powerful tool used in the field of Life Sciences. This antibody plays a crucial role in various biological processes, including interferon signaling and fas-mediated apoptosis. It is also involved in the production of autoantibodies, collagen synthesis, glycosylation, and fibroin formation.
