Primary Antibodies

<p>LBX2 antibody was raised in rabbit using the middle region of LBX2 as the immunogen</p>

<p>USP2 antibody was raised in rabbit using the N terminal of USP2 as the immunogen</p>

<p>AGR2 antibody was raised using a synthetic peptide corresponding to a region with amino acids AEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLY</p>

<p>MFRP antibody was raised using the middle region of MFRP corresponding to a region with amino acids HAIQLKIEALSIESVASCLFDRLELSPEPEGPLLRVCGRVPPPTLNTNAS</p>

<p>SPAG6 antibody was raised in rabbit using the middle region of SPAG6 as the immunogen</p>

<p>ADRM1 antibody was raised in rabbit using the C terminal of ADRM1 as the immunogen</p>

<p>Irf2bp1 antibody was raised in rabbit using the N terminal of Irf2bp1 as the immunogen</p>

<p>B4GALNT1 antibody was raised using the middle region of B4GALNT1 corresponding to a region with amino acids GLGSLRVGSCSDVVVDHASKLKLPWTSRDAGAETYARYRYPGSLDESQMA</p>

<p>LOC390338 antibody was raised in rabbit using the middle region of LOC390338 as the immunogen</p>

<p>AOC2 antibody (retina specific) was raised using a synthetic peptide corresponding to a region with amino acids QATMVDIHILVGKGAVQLLPGAVCVFEEAQGLPLRRHHNYLQNHFYGGLA</p>

<p>Purified Polyclonal CLIC4 antibody</p>

<p>LDLRAD1 antibody was raised using the middle region of LDLRAD1 corresponding to a region with amino acids DEDESLCRDVPQSLPHFLVAHCGDPASWIYSDQKCDGTNNCGDCSDELSP</p>

<p>COG5 antibody was raised in rabbit using the N terminal of COG5 as the immunogen</p>

<p>PWP1 antibody was raised in rabbit using the C terminal of PWP1 as the immunogen</p>

<p>SLC4A5 antibody was raised using the middle region of SLC4A5 corresponding to a region with amino acids SIAHIDSLKMETETSAPGEQPQFLGVREQRVTGIIVFILTGISVFLAPIL</p>

<p>ARSH antibody was raised using the middle region of ARSH corresponding to a region with amino acids FIERYKREPFLLFFSFLHVHTPLISKKKFVGRSKYGRYGDNVEEMDWMVG</p>

<p>RAB15 antibody was raised in rabbit using the middle region of RAB15 as the immunogen</p>

<p>Notch 1 homolog antibody was raised in rabbit using a synthetic peptide representing the C terminal region of the human NOTCH homolog 1 (NOTCH1) protein as the immunogen.</p>

Sepn1 antibody was raised in rabbit using the C terminal of Sepn1 as the immunogen

<p>ADA antibody was raised using the middle region of ADA corresponding to a region with amino acids ANYSLNTDDPLIFKSTLDTDYQMTKRDMGFTEEEFKRLNINAAKSSFLPE</p>

<p>ATXN2 antibody was raised in rabbit using the middle region of ATXN2 as the immunogen</p>

<p>Purified Polyclonal ATRIP antibody</p>

ESSPL antibody was raised using the N terminal of ESSPL corresponding to a region with amino acids MATDELATKLSRRLQMEGEGGGETPEQPGLNGAAAAAAGAPDEAAEALGS

<p>IL18R1 antibody was raised using the N terminal of IL18R1 corresponding to a region with amino acids PFYLKHCSCSLAHEIETTTKSWYKSSGSQEHVELNPRSSSRIALHDCVLE</p>

<p>RFP2 antibody was raised in rabbit using the middle region of RFP2 as the immunogen</p>

Factor II antibody was raised using a synthetic peptide corresponding to a region with amino acids KYEPFWEDEEKNESGLTEYRLVSINKSSPLQKQLPAFISEDASGYLTSSW

<p>ZNF687 antibody was raised in rabbit using the C terminal of ZNF687 as the immunogen</p>

BRAF35 antibody was raised in rabbit using residues 31-50 [KQERGEGPRA GEKGSHEEEP] of the human structural DNA-binding protein BRAF35 as the immunogen.

<p>MYD88 antibody was raised using a synthetic peptide corresponding to a region with amino acids YLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGP</p>

<p>OR2AT4 antibody was raised using the N terminal of OR2AT4 corresponding to a region with amino acids MDATACNESVDGSPVFYLLGIPSLPETFFLPVFFIFLLFYLLILMGNALI</p>

<p>RBBP5 antibody was raised in rabbit using the middle region of RBBP5 as the immunogen</p>

<p>JAZF1 antibody was raised in rabbit using the C terminal of JAZF1 as the immunogen</p>

<p>TMTC2 antibody was raised using the N terminal of TMTC2 corresponding to a region with amino acids SNSDNPAADSDSLLTRTLTFFYLPTKNLWLLLCPDTLSFDWSMDAVPLLK</p>

<p>SMPD1 antibody was raised using the middle region of SMPD1 corresponding to a region with amino acids INSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKSWSWNYYRIV</p>

PPP5C antibody was raised in rabbit using the middle region of PPP5C as the immunogen

<p>SIGLEC10 antibody was raised using the middle region of SIGLEC10 corresponding to a region with amino acids CHVDFSRKGVSAQRTVRLRVAYAPRDLVISISRDNTPALEPQPQGNVPYL</p>

<p>LUC7L antibody was raised in rabbit using the N terminal of LUC7L as the immunogen</p>

<p>Morf4l1 antibody was raised in rabbit using the middle region of Morf4l1 as the immunogen</p>

<p>USP47 antibody was raised in rabbit using the middle region of USP47 as the immunogen</p>

<p>Vgll2 antibody was raised in rabbit using the N terminal of Vgll2 as the immunogen</p>

<p>Eras antibody was raised in rabbit using the N terminal of Eras as the immunogen</p>

<p>Mapk12 antibody was raised in rabbit using the C terminal of Mapk12 as the immunogen</p>

Purified Polyclonal LATH antibody

<p>XYLT1 antibody was raised in rabbit using the middle region of XYLT1 as the immunogen</p>

<p>HOMEZ antibody was raised in rabbit using the middle region of HOMEZ as the immunogen</p>

<p>Purified Polyclonal CstF50 antibody</p>

<p>LRRC14 antibody was raised in rabbit using the C terminal of LRRC14 as the immunogen</p>

<p>Affinity purified Goat polyclonal Synphilin 1 antibody</p>

<p>GRO beta antibody was raised in rabbit using highly pure recombinant human GRO-beta as the immunogen.</p>

ZNF441 antibody was raised in rabbit using the N terminal of ZNF441 as the immunogen

<p>SH2B1 antibody was raised using the middle region of SH2B1 corresponding to a region with amino acids GTSFLTRENTDSLELSCLNHSESLPSQDLLLGPSESNDRLSQGAYGGLSD</p>

NCF4 antibody was raised using the N terminal of NCF4 corresponding to a region with amino acids SKYLIYRRYRQFHALQSKLEERFGPDSKSSALACTLPTLPAKVYVGVKQE

<p>PI3 antibody was raised using a synthetic peptide corresponding to a region with amino acids KGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTKPGSCPIILIRCAM</p>

<p>ZNF560 antibody was raised in rabbit using the middle region of ZNF560 as the immunogen</p>

KIAA0317 antibody was raised using the N terminal of KIAA0317 corresponding to a region with amino acids LTCGQPHTLQIVPRDEYDNPTNNSMSLRDEHNYTLSIHELGPQEEESTGV

<p>CENPN antibody was raised in rabbit using the middle region of CENPN as the immunogen</p>

Estrogen Receptor 1 antibody was raised using the middle region of ESR1 corresponding to a region with amino acids LLEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEAE

<p>ZNF683 antibody was raised in rabbit using the N terminal of ZNF683 as the immunogen</p>

Rpsa antibody was raised in rabbit using the N terminal of Rpsa as the immunogen

<p>CYP3A43 antibody was raised using the C terminal of CYP3A43 corresponding to a region with amino acids IYALHHDPKYWTEPEKFCPESRFSKKNKDSIDLYRYIPFGAGPRNCIGMR</p>

PSG5 antibody was raised using the middle region of PSG5 corresponding to a region with amino acids SIPQITTKHRGLYTCSVRNSATGKESSKSMTVEVSAPSGIGRLPLLNPI

MS4A4A antibody was raised using the N terminal of MS4A4A corresponding to a region with amino acids MHQTYSRHCRPEESTFSAAMTTMQGMEQAMPGAGPGVPQLGNMAVIHSHL

ITAC antibody was raised in rabbit using highly pure recombinant human I-TAC as the immunogen.

<p>IGF1 antibody was raised in rabbit using highly pure recombinant human IGF-I as the immunogen.</p>

<p>The HSP27 antibody is a protein that specifically targets and binds to Heat Shock Protein 27 (HSP27). HSP27 is an acidic protein that plays a crucial role in cellular protection and stress response. It is highly expressed in various cell types, including mesenchymal stem cells, and has been shown to have natriuretic properties, promoting the excretion of sodium ions.</p>

<p>CD5 antibody was raised using the N terminal of CD5 corresponding to a region with amino acids MPMGSLQPLATLYLLGMLVASCLGRLSWYDPDFQARLTRSNSKCQGQLEV</p>

Mrps33 antibody was raised in rabbit using the middle region of Mrps33 as the immunogen

<p>NKX2-4 antibody was raised in rabbit using the C terminal of NKX2-4 as the immunogen</p>

<p>PAM antibody was raised using the N terminal of PAM corresponding to a region with amino acids PKGVGFRVGGETGSKYFVLQVHYGDISAFRDNNKDCSGVSLHLTRLPQPL</p>

<p>IL22R alpha 1 antibody was raised using the middle region of IL22RA1 corresponding to a region with amino acids YRYVTKPPAPPNSLNVQRVLTFQPLRFIQEHVLIPVFDLSGPSSLAQPVQ</p>

<p>HOXA11 antibody was raised in rabbit using the middle region of HOXA11 as the immunogen</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth, preventing transcription and replication. This drug has been extensively studied using advanced techniques like the patch-clamp technique on human erythrocytes. Metabolized through various transformations, including hydrolysis and oxidation, it specifically targets markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth. Trust this potent drug for effective treatment against tuberculosis.</p>

<p>CHERP antibody was raised using the middle region of CHERP corresponding to a region with amino acids EQGIQDPIKGGDVRDKWDQYKGVGVALDDPYENYRRNKSYSFIARMKARD</p>

<p>PON1 antibody was raised using the middle region of PON1 corresponding to a region with amino acids VVAEGFDFANGINISPDGKYVYIAELLAHKIHVYEKHANWTLTPLKSLDF</p>

OPG antibody was raised in rabbit using highly pure recombinant human OPG (human Osteoprotegerin) as the immunogen.

<p>Slc7a3 antibody was raised in rabbit using the middle region of Slc7a3 as the immunogen</p>

<p>TACI antibody was raised in goat using highly pure recombinant human TACI as the immunogen.</p>

<p>FAM62B antibody was raised using a synthetic peptide corresponding to a region with amino acids NSGPNSTIKMKIALRVLHLEKRERPPDHQHSAQVKRPSVSKEGRKTSIKS</p>

OSBPL8 antibody was raised using the N terminal of OSBPL8 corresponding to a region with amino acids SQRQGKEAYPTPTKDLHQPSLSPASPHSQGFERGKEDISQNKDESSLSMS

<p>PORCN antibody was raised using a synthetic peptide corresponding to a region with amino acids ACRLLWRLGLPSYLKHASTVAGGFFSLYHFFQLHMVWVVLLSLLCYLVLF</p>

Purified Polyclonal CEP70 antibody

<p>Fam55d antibody was raised in rabbit using the C terminal of Fam55d as the immunogen</p>

Rabbit polyclonal PSA antibody (Prediluted for IHC)

<p>PRDM13 antibody was raised in rabbit using the N terminal of PRDM13 as the immunogen</p>

<p>KLHL5 antibody was raised in rabbit using the middle region of KLHL5 as the immunogen</p>

<p>PSMD3 antibody was raised in rabbit using the middle region of PSMD3 as the immunogen</p>

IL6 antibody was raised in goat using highly pure recombinant rat IL-6 as the immunogen.

<p>GAL3ST3 antibody was raised in rabbit using the middle region of GAL3ST3 as the immunogen</p>

<p>Bnip3l antibody was raised in rabbit using the middle region of Bnip3l as the immunogen</p>

RFPL3 antibody was raised in rabbit using the middle region of RFPL3 as the immunogen

<p>ITLN1 antibody was raised in rabbit using the middle region of ITLN1 as the immunogen</p>

PSME1 antibody was raised using the middle region of PSME1 corresponding to a region with amino acids KEKEERKKQQEKEDKDEKKKGEDEDKGPPCGPVNCNEKIVVLLQRLKPEI

GRO antibody was raised in rabbit using highly pure recombinant rat GRO/KC as the immunogen.

HDAC9 antibody was raised using the middle region of HDAC9 corresponding to a region with amino acids GQVGAVKVKEEPVDSDEDAQIQEMESGEQAAFMQQVIGKDLAPGFVIKVI

<p>CALCR antibody was raised in rabbit using the C terminal of CALCR as the immunogen</p>

<p>Prdm12 antibody was raised in rabbit using the middle region of Prdm12 as the immunogen</p>

<p>ZNF585B antibody was raised in rabbit using the N terminal of ZNF585B as the immunogen</p>

Human synthetic cyclin E1 C-terminal KLH-conjugated immunogen; purified polyclonal Cyclin E1 antibody

<p>EIF3H antibody was raised in rabbit using the C terminal of EIF3H as the immunogen</p>

NKX6-3 antibody was raised in rabbit using the middle region of NKX6-3 as the immunogen