Primary Antibodies

Mouse Anti Mullerian Hormone antibody

Rabbit polyclonal S1PR5 antibody

The BTK antibody is a highly specialized antibody that targets and neutralizes the activity of Bruton's tyrosine kinase (BTK). BTK is an enzyme that plays a crucial role in the activation of B cells, which are important components of the immune system. By inhibiting BTK, this antibody can effectively suppress the production of inflammatory cytokines such as tumor necrosis factor-alpha (TNF-α) and reduce the proliferation of B cells.

<p>The DP2 antibody is a polyclonal antibody that is widely used in Life Sciences research. It is commonly used for acetylation staining and detection of collagen in various biological samples. This antibody can also be used for the development of new medicines and vaccines, as it specifically targets antigens related to specific diseases or conditions.</p>

<p>Mouse monoclonal OGFOD1 antibody</p>

<p>The PGD antibody is a powerful tool used in Life Sciences research. It specifically targets and binds to Prostaglandin D2 (PGD2), a lipid mediator involved in various physiological processes. The antibody, whether polyclonal or monoclonal, recognizes specific epitopes on PGD2 and can be utilized for various applications.</p>

<p>DDX39 antibody was raised in Rabbit using Human DDX39 as the immunogen</p>

<p>DBX2 antibody was raised in rabbit using the N terminal of DBX2 as the immunogen</p>

The SARS-CoV-2 Spike Antibody is a highly effective tool for immunoassays and research in the field of Life Sciences. This antibody specifically targets the spike protein of the SARS-CoV-2 virus, which is responsible for receptor binding and entry into host cells.

<p>The ATF2 antibody is a cytotoxic antibody that specifically targets and binds to ATF2, an important transcription factor involved in cellular processes such as cell growth, differentiation, and apoptosis. This monoclonal antibody has been extensively studied in the field of Life Sciences and has shown inhibitory effects on ATF2 activity. It has been used in various research applications, including the study of antiphospholipid antibodies and their role in autoimmune diseases. Additionally, the ATF2 antibody has demonstrated anticoagulant properties and can be used as a potential therapeutic agent for conditions related to abnormal clotting. With its high specificity and affinity for ATF2, this antibody offers great potential for further research in the field of molecular biology and immunology.</p>

<p>The Mcm7 antibody is a cytotoxic monoclonal antibody that belongs to the category of Life Sciences products. It has been specifically designed to target and neutralize the activated form of Mcm7, an inhibitory factor involved in various biological processes. This antibody has been shown to have neuroprotective properties and can inhibit the activity of interleukin-6, a hormone peptide involved in inflammatory responses. Additionally, it has been found to interact with cholinergic receptors and exhibit inhibitory effects on liver microsomes. The Mcm7 antibody is a highly specialized tool for researchers in the field of Life Sciences who are studying the role of Mcm7 in cellular processes and its potential as a therapeutic target.</p>

The SERPINA1 antibody is a polyclonal antibody that has colloidal properties and acts as a neutralizing and inhibitory factor. It can bind to streptavidin, annexin A2, glucagon, chemokine, and other activated molecules. This antibody is widely used in the field of Life Sciences for research purposes. It can also be used in diagnostic applications to detect the presence of specific proteins or autoantibodies. The SERPINA1 antibody is available in both polyclonal and monoclonal forms, providing researchers with options based on their specific needs. With its high specificity and affinity for the target molecule, this antibody is a valuable tool in various scientific investigations.

Rabbit polyclonal Akt1S1 antibody

<p>Rabbit polyclonal RXFP3 antibody</p>

<p>The p16 antibody is a polyclonal antibody that is commonly used in Life Sciences research. It specifically targets the p16 protein, which plays a crucial role in cell cycle regulation and tumor suppression. This antibody is highly sensitive and can be used for various applications such as immunohistochemistry, Western blotting, and flow cytometry.</p>

Rabbit polyclonal RPL11 antibody (FITC)

<p>Rabbit polyclonal TrkA antibody (Tyr496)</p>

<p>Mouse monoclonal CK2 beta antibody</p>

<p>The CKMB antibody is a biomolecule that plays a crucial role in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to CKMB (creatine kinase-MB), an enzyme found in cardiac muscle cells. This antibody has been extensively used in research and diagnostic applications related to cardiovascular diseases.</p>

<p>The CCRL2 antibody is a highly specialized antibody that targets the glucagon hormone. It belongs to the class of polyclonal antibodies and has been specifically designed to neutralize the acidic properties of glucagon. This antibody has shown neuroprotective effects in various studies and has been found to inhibit the activity of the circumsporozoite protein, an antigen associated with malaria infection.</p>

The Influenza B antibody is a highly reactive monoclonal antibody derived from human serum. It possesses neutralizing properties and has been shown to effectively immobilize the influenza virus. This antibody specifically targets the hemagglutinin protein found on the surface of the influenza virus, preventing it from infecting host cells.

The DPP3 antibody is a monoclonal antibody that has cytotoxic properties. It is used in various applications such as ketamine therapy, carbamazepine treatment, and epidermal growth factor studies. This antibody specifically targets DPP3, a protein involved in multiple pathways including annexin signaling, multidrug resistance, TGF-beta regulation, and growth factor interactions. By binding to DPP3, this antibody can inhibit its activity and disrupt these pathways. Additionally, the DPP3 antibody has been shown to interact with other proteins such as fibrinogen, lipoprotein lipase, interferon, and collagen. Its versatile nature makes it a valuable tool for research and therapeutic purposes.

<p>Affinity purified Rabbit polyclonal UBE4B antibody</p>

C7 antibody was raised in Rabbit using Human C7 as the immunogen

<p>SEPP1 antibody was raised using the N terminal of SEPP1 corresponding to a region with amino acids LGLALALCLLPSGGTESQDQSSLCKQPPAWSIRDQDPMLNSNGSVTVVAL</p>

DDX23 antibody was raised using a synthetic peptide corresponding to a region with amino acids EDSAVFYELKQAILESPVSSCPPELANHPDAQHKPGTILTKKRREETIFA

<p>The PCAF antibody is a monoclonal antibody used in the field of Life Sciences. It has been shown to have neutralizing effects on irinotecan, a cytotoxic drug used in cancer treatment. This antibody specifically targets and binds to fibrinogen, a glycoprotein involved in blood clotting. The PCAF antibody can be used in immunoassays to detect and quantify fibrinogen levels in biological samples. Additionally, it can be utilized for research purposes such as studying the activation of specific cell signaling pathways or investigating the role of fibrinogen in various physiological processes. This high-quality antibody is produced using advanced techniques and has been extensively tested for its efficacy and specificity.</p>

<p>The CHK1 antibody is a highly versatile and potent growth factor that has a wide range of applications. It has been extensively studied for its role in collagen synthesis and its ability to scavenge superoxide radicals, making it an effective antiangiogenic agent. The CHK1 antibody also promotes endothelial cell growth and regulates actin filament dynamics, contributing to the formation of new blood vessels. Additionally, it has been shown to modulate erythropoietin-induced phalloidin binding and dopamine agglutination assay.</p>

Influenza A antibody (Matrix) (FITC) was raised in goat using influenza A, Phillipines (H3N2) as the immunogen.

Rabbit polyclonal CBL antibody (Tyr774)

The FANCA antibody is a polyclonal antibody that targets the purinergic receptor in mesenchymal stem cells and hematopoietic stem cells. This antibody is commonly used as a research reagent in the field of life sciences. It has shown potential as an anti-neoplastic agent, with studies suggesting its ability to inhibit the growth of cancer cells. The FANCA antibody interacts with G-protein coupled receptors, specifically targeting those expressed on mesenchymal stem cells. It can also be used in studies involving pluripotent stem cells and hematopoietic stem cells. Additionally, this antibody has been found to have an effect on cellular processes such as butyrate signaling. Its versatility and potential therapeutic applications make it a valuable tool for researchers in various fields.

<p>CACNG3 antibody was raised in Rabbit using Human CACNG3 as the immunogen</p>

<p>FK506 antibody was raised in mouse using Tacrolimus conjugated to BSA as the immunogen.</p>

The SAA1 Antibody is a highly effective antiviral inhibitor that is widely used in the field of Life Sciences. This antibody specifically targets human serum and has been shown to have a neutralizing effect on alpha-fetoprotein, a growth factor associated with various diseases. Additionally, the SAA1 Antibody exhibits strong binding affinity to antibodies such as fibrinogen, anti-mesothelin, and anti-cd33 antibody. This makes it an invaluable tool for researchers working with Monoclonal Antibodies. The SAA1 Antibody can be easily applied using an electrode for precise and accurate results. With its exceptional specificity and effectiveness, this antibody is a must-have for any laboratory or research facility.

<p>Rabbit polyclonal GALR1 antibody</p>

<p>ADD3 antibody was raised in Rabbit using Human ADD3 as the immunogen</p>

<p>Rabbit polyclonal RPL15 antibody (FITC)</p>

<p>TPI1 antibody was raised using the N terminal of TPI1 corresponding to a region with amino acids MAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYID</p>

Purified Polyclonal ABHD9 antibody

<p>Rabbit polyclonal AKT1/3 antibody (Tyr437/434)</p>

<p>The E Cadherin antibody is a polyclonal antibody that is used in Life Sciences research. It specifically targets E-cadherin, a protein involved in cell adhesion and cell signaling. This antibody can be used for various applications, including immunohistochemistry, Western blotting, and flow cytometry. It has been shown to have antiviral properties and can neutralize the activity of certain growth factors and chemokines. Additionally, the E Cadherin antibody has been used in studies involving granulosa cells and colony-stimulating factor. Its high specificity and affinity make it a valuable tool for researchers in the field of Life Sciences.</p>

The iNOS antibody is a specific antibody that targets inducible nitric oxide synthase (iNOS), an enzyme involved in the production of nitric oxide. This antibody has been shown to be highly effective in detecting and quantifying iNOS expression in various biological samples. It can be used for research purposes in fields such as life sciences, immunology, and cell biology.

Rabbit polyclonal PSMD2 antibody

Mouse monoclonal IFT57 antibody

<p>IMPA1 antibody was raised using the middle region of IMPA1 corresponding to a region with amino acids IVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKEIQVIPLQRDDE</p>

The NRG1 antibody is a powerful therapeutic tool in the field of Life Sciences. It acts as a DPP4 inhibitor, targeting and inhibiting the activity of dipeptidyl peptidase-4. This antibody has been extensively studied for its potential applications in various areas, including adipose tissue research, interferon signaling pathways, and choroidal neovascularization.

<p>The IL3 antibody is a polyclonal antibody that is used for the immobilization of gm-csf, a colony-stimulating factor. It can be used in various applications such as ELISA and western blotting. The IL3 antibody has been shown to have high specificity and sensitivity when tested with human serum samples. It can also be used in conjunction with other antibodies, such as phalloidin, to study the effects of steroids on cell growth and differentiation. Additionally, monoclonal antibodies against tgf-β1 have been developed using flavobacterium heparinum as an immunogen. These antibodies have been shown to inhibit the cytotoxic effects of tgf-β1 and may have potential therapeutic applications in cancer treatment.</p>

AK3 antibody is a monoclonal antibody widely used in various assays and experiments in the field of Life Sciences. It is specifically designed to target and bind to AK3, an important glycoprotein involved in various cellular processes. This antibody has been shown to be highly specific and sensitive in detecting the presence of AK3 in samples.

<p>Affinity purified Rabbit polyclonal Calpain 5 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections. This active compound exhibits bactericidal activity by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its potency has been demonstrated through various scientific techniques such as the patch-clamp technique on human erythrocytes. The drug undergoes several metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>The NMDAR2B antibody is a pharmacological tool that belongs to the class of antibodies. It is used in Life Sciences research to study the role of NMDA receptors, specifically the NMDAR2B subunit, in various cellular processes. This antibody has been shown to modulate intracellular calcium levels and lactate production. It also interacts with other proteins such as apolipoprotein and fibrinogen, suggesting its involvement in multiple signaling pathways. The NMDAR2B antibody can be used as an inhibitor to block the activity of NMDA receptors and investigate their function in different experimental settings. Its high specificity and affinity make it a valuable tool for researchers in the field of neuroscience and drug discovery.</p>

<p>DNA2L antibody was raised using the middle region of Dna2L corresponding to a region with amino acids KLELEFYADYSDNPWLMGVFEPNNPVCFLNTDKVPAPEQVEKGGVSNVTE</p>

<p>HOMER1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QEQRDSLTQKLQEVEIRNKDLEGQLSDLEQRLEKSQNEQEAFRNNLKTLL</p>

<p>Rabbit polyclonal FTH1 antibody (biotin)</p>

<p>Purified Polyclonal NDUFV2 antibody</p>

<p>Rabbit polyclonal Ferritin heavy chain antibody (FITC)</p>

<p>Rabbit polyclonal UTP3 antibody</p>

<p>CCDC44 antibody was raised in Rabbit using Human CCDC44 as the immunogen</p>

<p>Mouse monoclonal alpha Actin antibody (smooth muscle)</p>

<p>LCP1 antibody was raised in Rabbit using Human LCP1 as the immunogen</p>

<p>Purified Rabbit polyclonal PRKCG antibody</p>

<p>TBCCD1 antibody was raised using the N terminal of TBCCD1 corresponding to a region with amino acids WPSPRNKSQSPDLTEKSNCHNKNWNDYSHQAFVYDHLSDLLELLLDPKQL</p>

<p>Rabbit polyclonal WRKY11 antibody</p>

<p>Rabbit polyclonal KCY antibody</p>

<p>CSNK1D antibody was raised in Rabbit using Human CSNK1D as the immunogen</p>

The SSX1 antibody is a highly specialized product in the field of Life Sciences. It is designed to target and bind to specific molecules involved in cortisol concentration regulation. This monoclonal antibody is engineered to have a high affinity for its target, ensuring effective binding and inhibition of cortisol activity.

<p>The STAT1 antibody is a highly specialized protein that plays a crucial role in various biological processes. It is an autoantibody that specifically targets the nuclear receptor STAT1, which regulates the expression of genes involved in immune responses and cell growth. This monoclonal antibody has been extensively studied in the field of Life Sciences and has shown promising results.</p>

<p>entB Monoclonal Antibody</p>

<p>Rabbit polyclonal CDK5RAP3 antibody</p>

<p>The SYK antibody is a highly effective chromatographic tool used in scientific research. It is available in both polyclonal and monoclonal forms, allowing for versatile applications. This antibody specifically targets SYK (spleen tyrosine kinase), a protein involved in various cellular processes such as hepatocyte growth and immune response regulation.</p>

<p>The STAR antibody is a monoclonal antibody that targets the epidermal growth factor (EGF) and inhibits its activity. It is commonly used in Life Sciences research to study the role of EGF in various cellular processes. This antibody specifically binds to EGF and prevents it from binding to its receptors, thereby blocking downstream signaling pathways. The STAR antibody has been shown to have cytotoxic effects on cells that overexpress EGF receptors, making it a valuable tool for studying the effects of EGF signaling in cancer cells. Additionally, this antibody has been used to investigate the role of EGF in thrombocytopenia and hyaluronic acid metabolism. Its ability to inhibit EGF-mediated nuclear translocation and TGF-β1-induced alpha-synuclein expression highlights its potential therapeutic applications in diseases related to aberrant growth factor signaling.</p>

<p>Affinity purified Rabbit polyclonal NDUFV2 antibody</p>

<p>Cytokeratin 75 antibody was raised using the middle region of KRT75 corresponding to a region with amino acids SFTTSGGHSLGAGLGGSGFSATSNRGLGGSGSSVKFVSTTSSSQKSYTH</p>

Rabbit polyclonal MAP3K1 antibody (HRP)

<p>The CD11c antibody is a monoclonal antibody that is widely used in the field of Life Sciences. It specifically targets the CD11c protein, which is found on the surface of certain immune cells, such as dendritic cells. This antibody has been extensively studied and has proven to be highly effective in various research applications.</p>

<p>C20orf132 antibody was raised using the middle region of C20orf132 corresponding to a region with amino acids PHLENLDTIIKLPLRFQRLGHLVALMALLCGDPQEKVAEEAAEGIHSLLH</p>

<p>Rabbit polyclonal ARPC3 antibody (biotin)</p>

<p>The BRAF antibody is a monoclonal antibody that specifically targets the protein kinase encoded by the BRAF gene. It is widely used in research and diagnostic applications to detect the presence of BRAF mutations, which are commonly associated with various types of cancer. The antibody works by binding to the oncogene homolog protein and facilitating its detection through techniques such as immunohistochemistry and polymerase chain reaction. This highly specific antibody provides reliable results with minimal background noise, making it an essential tool for researchers in the field of life sciences. Additionally, it can be used in combination with other antibodies or inhibitors to study the signaling pathways involved in cancer development and progression. Whether you're conducting basic research or performing clinical diagnostics, this BRAF antibody is a valuable asset that will enhance your studies and provide valuable insights into oncogenic processes.</p>

<p>Purified Polyclonal ELOVL6 antibody</p>

Rabbit Polyclonal LKB1 antibody (Ser334)

<p>The ARHGAP26 antibody is a highly specialized monoclonal antibody that targets the alpha-fetoprotein. It is commonly used in Life Sciences research to study the activation of colony-stimulating factors, specifically the macrophage colony-stimulating factor (m-CSF). This antibody is designed to recognize specific amino acid residues in the target protein and has been extensively tested for its specificity and sensitivity. The ARHGAP26 antibody is also useful in Polyclonal Antibody applications, where it can be used to detect and quantify the presence of the vasoactive intestinal peptide (VIP) in human serum samples. With its high affinity and selectivity, this antibody provides accurate and reliable results for various research purposes.</p>

<p>DDI1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KNVLVIGTTGTQTYFLPEGELPLCSRMVSGQDESSDKEITHSVMDSGRKE</p>

Mouse monoclonal SLC2A5 antibody

Mouse monoclonal NUDT6 antibody

<p>Rabbit polyclonal ALPL antibody</p>

<p>GTPBP9 antibody was raised using a synthetic peptide corresponding to a region with amino acids QAAGKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGRNYIVE</p>

<p>BMP2 antibody was raised in rabbit using highly pure recombinant human BMP-2 as the immunogen.</p>

<p>Rabbit polyclonal AKAP2 antibody</p>

Rabbit polyclonal Hemoglobin antibody (biotin)

<p>The TFF2 antibody is a potent botulinum family kinase inhibitor that has neutralizing properties. It belongs to the category of polyclonal antibodies and is widely used in the field of life sciences. This antibody can be used in various applications, including electrode assays and carbamazepine studies. Additionally, it has been shown to have cytotoxic effects on specific cell types and exhibits natriuretic activity. The TFF2 antibody is also known for its anti-MERTK antibody properties, making it an excellent choice for targeting activated receptors. It is formulated with high-quality excipients and is a glycoprotein-based product.</p>

<p>Lamin B Receptor antibody was raised using the middle region of LBR corresponding to a region with amino acids GANSQKNAFRKNPSDPKLAHLKTIHTSTGKNLLVSGWWGFVRHPNYLGDL</p>

PPM1 (PP2A Methyltransferase) Monoclonal Antibody

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This compound works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its efficacy has been demonstrated through extensive research using advanced techniques like the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

Mouse monoclonal ACAT2 antibody

<p>The NTRK3 antibody is a highly specialized monoclonal antibody that targets the neurotrophic tyrosine kinase receptor 3 (NTRK3). This receptor plays a crucial role in neuronal development and function. The NTRK3 antibody binds to the receptor, inhibiting its activity and preventing downstream signaling pathways.</p>

The JAK2 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and neutralize the Janus kinase 2 (JAK2) protein, which plays a crucial role in various cellular processes such as growth factor signaling and immune response. This antibody is particularly effective in research applications where the inhibition of JAK2 activity is desired.

<p>The Cyclin D1 antibody is a highly specific monoclonal antibody that is used in flow immunoassays to detect and quantify the presence of Cyclin D1 in human serum samples. This antibody is widely used in Life Sciences research and has been proven to be a valuable tool for studying the role of Cyclin D1 in various biological processes.</p>

<p>SLC26A8 antibody was raised using the C terminal of SLC26A8 corresponding to a region with amino acids EPQPETEPEMEPNPKSRPRAHTFPQQRYWPMYHPSMASTQSQTQTRTWSV</p>

<p>The ADAM10 antibody is a highly specialized cytotoxic antibody that targets the tyrosine protease ADAM10. It is widely used in Life Sciences research, particularly in immunohistochemistry studies. This polyclonal antibody has been shown to inhibit the activity of ADAM10, which plays a crucial role in various cellular processes such as interleukin-6 and insulin signaling. The ADAM10 antibody is commonly used as a tool to study the function of this protein and its involvement in disease pathways. Researchers also use monoclonal antibodies against ADAM10 for specific applications, such as insulin or interleukin detection. Additionally, this antibody has potential therapeutic applications due to its ability to modulate ADAM10 activity and downstream effects on cellular processes. Its specificity and high affinity make it an essential tool for studying the biology of ADAM10 and its associated pathways.</p>

Mouse monoclonal PLEK antibody