Primary Antibodies

<p>JMJD5 antibody was raised in rabbit using the N terminal of JMJD5 as the immunogen</p>

<p>PDGFD antibody was raised using the N terminal of PDGFD corresponding to a region with amino acids NANLRRDESNHLTDLYRRDETIQVKGNGYVQSPRFPNSYPRNLLLTWRLH</p>

ALDH3A2 antibody was raised using the middle region of ALDH3A2 corresponding to a region with amino acids DHIFYTGNTAVGKIVMEAAAKHLTPVTLELGGKSPCYIDKDCDLDIVCRR

<p>Chondroadherin antibody was raised using the middle region of CHAD corresponding to a region with amino acids LSPLVNLFILQLNNNKIRELRAGAFQGAKDLRWLYLSENALSSLQPGALD</p>

<p>Artemin antibody was raised in rabbit using highly pure recombinant human artemin as the immunogen.</p>

<p>Purified Polyclonal ACTN1/2/3/4 antibody</p>

<p>ZNF708 antibody was raised in rabbit using the C terminal of ZNF708 as the immunogen</p>

<p>FLJ44894 antibody was raised in rabbit using the N terminal of FLJ44894 as the immunogen</p>

<p>Ppp2r2d antibody was raised in rabbit using the C terminal of Ppp2r2d as the immunogen</p>

<p>TRIM17 antibody was raised in rabbit using the middle region of TRIM17 as the immunogen</p>

<p>The AQP1 antibody is a highly specialized monoclonal antibody that targets the aquaporin 1 protein. Aquaporin 1 is a transmembrane protein that facilitates the transport of water across cell membranes. This antibody has been extensively studied and shown to have a high affinity for aquaporin 1, making it an excellent tool for research in various fields such as life sciences.</p>

AOC2 antibody (retina specific) was raised using a synthetic peptide corresponding to a region with amino acids AEDIPNTVTLGNRVGFLLRPYNFFDEDPSIFSPGSVYFEKGQDAGLCSIN

<p>UBA1 antibody was raised using the N terminal of UBA1 corresponding to a region with amino acids MEAGPPGSARPAEPGPCLSGQRGADHTASASLQSVAGTEPGRHPQAVAAV</p>

<p>C16ORF58 antibody was raised using the N terminal Of C16Orf58 corresponding to a region with amino acids QAVFLPQGFPDSVSPDYLPYQLWDSVQAFASSLSGSLATQAVLLGIGVGN</p>

<p>Gnpda1 antibody was raised in rabbit using the N terminal of Gnpda1 as the immunogen</p>

<p>Purified Polyclonal ANT3 antibody</p>

<p>Asrgl1 antibody was raised in rabbit using the C terminal of Asrgl1 as the immunogen</p>

<p>The ZHX2 antibody is a powerful tool used in the field of Life Sciences. It specifically targets and binds to collagen, a protein found abundantly in the body. This antibody has shown antinociceptive properties, meaning it can help alleviate pain sensations. Additionally, it has been observed to be effective in inhibiting the activation of certain phosphorylation sites, which play a crucial role in cellular signaling pathways.</p>

<p>MIF antibody was raised in rabbit using the middle region of MIF as the immunogen</p>

<p>ST6GALNAC3 antibody was raised using the C terminal of ST6GALNAC3 corresponding to a region with amino acids HYYEQGRDECDEYFLHEHAPYGGHRFITEKKVFAKWAKKHRIIFTHPNWT</p>

<p>CAMKII antibody was raised using the N terminal of CAMKK2 corresponding to a region with amino acids GGLAAGGSLDMNGRCICPSLPYSPVSSPQSSPRLPRRPTVESHHVSITGM</p>

<p>PSMB10 antibody was raised using a synthetic peptide corresponding to a region with amino acids DLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQG</p>

<p>FGF13 antibody was raised using the middle region of FGF13 corresponding to a region with amino acids TKLYSRQGYHLQLQADGTIDGTKDEDSTYTLFNLIPVGLRVVAIQGVQTK</p>

<p>SMC2 antibody was raised using the middle region of SMC2 corresponding to a region with amino acids ATLAGQMMACKNDISKAQTEAKQAQMKLKHAQQELKNKQAEVKKMDSGYR</p>

<p>PODXL antibody was raised using the middle region of PODXL corresponding to a region with amino acids PATALRTPTLPETMSSSPTAASTTHRYPKTPSPTVAHESNWAKCEDLETQ</p>

<p>TMEM161B antibody was raised using the N terminal of TMEM161B corresponding to a region with amino acids GSLRWYQHPTEEELRILAGKQQKGKTKKDRKYNGHIESKPLTIPKDIDLH</p>

<p>MRGPRX3 antibody was raised in rabbit using the C terminal of MRGPRX3 as the immunogen</p>

<p>OAS2 antibody was raised using the middle region of OAS2 corresponding to a region with amino acids AKGTALKTGSDADLVVFHNSLKSYTSQKNERHKIVKEIHEQLKAFWREKE</p>

<p>TRMT6 antibody was raised in rabbit using the middle region of TRMT6 as the immunogen</p>

ZFP42 antibody was raised in rabbit using the middle region of ZFP42 as the immunogen

<p>SIRT7 antibody was raised in rabbit using the C terminal of SIRT7 as the immunogen</p>

<p>ZNF433 antibody was raised in rabbit using the N terminal of ZNF433 as the immunogen</p>

<p>The CD298 antibody is a highly specific monoclonal antibody that targets DNA-binding proteins. It is widely used in the field of Life Sciences for various applications, including research and diagnostics. This antibody binds specifically to the surface glycoprotein CD298, forming a specific complex that can be detected using techniques such as electrochemical impedance spectroscopy. The CD298 antibody has been shown to have high affinity and specificity for its target, making it a valuable tool for studying the function and localization of DNA-binding proteins in various biological systems. Additionally, this antibody has been used in studies investigating the role of CD298 in processes such as glutamate signaling and proteolytic activity. With its versatility and reliability, the CD298 antibody is an essential tool for researchers working in the field of DNA-binding proteins.</p>

<p>SERTAD2 antibody was raised in rabbit using the N terminal of SERTAD2 as the immunogen</p>

<p>SNRPA antibody was raised in rabbit using the N terminal of SNRPA as the immunogen</p>

<p>WNT2B antibody was raised in rabbit using the middle region of WNT2B as the immunogen</p>

<p>Armcx1 antibody was raised in rabbit using the C terminal of Armcx1 as the immunogen</p>

<p>Rad21 antibody was raised in rabbit using the N terminal of Rad21 as the immunogen</p>

<p>LRRC59 antibody was raised using the C terminal of LRRC59 corresponding to a region with amino acids KEYDALKAAKREQEKKPKKEANQAPKSKSGSRPRKPPPRKHTRSWAVLKL</p>

<p>TMPRSS4 antibody was raised in rabbit using the N terminal of TMPRSS4 as the immunogen</p>

<p>KCNG1 antibody was raised using the N terminal of KCNG1 corresponding to a region with amino acids MTLLPGDNSDYDYSALSCTSDASFHPAFLPQRQAIKGAFYRRAQRLRPQD</p>

<p>CLPTM1L antibody was raised using the middle region of CLPTM1L corresponding to a region with amino acids KAFTYKAFNTFIDDVFAFIITMPTSHRLACFRDDVVFLVYLYQRWLYPVD</p>

<p>ACBD4 antibody was raised using the N terminal of ACBD4 corresponding to a region with amino acids MGTEKESPEPDCQKQFQAAVSVIQNLPKNGSYRPSYEEMLRFYSYYKQAT</p>

<p>ZNF714 antibody was raised in rabbit using the N terminal of ZNF714 as the immunogen</p>

<p>C19orf2 antibody was raised in rabbit using the middle region of C19ORF2 as the immunogen</p>

<p>IL7 antibody was raised in rabbit using highly pure recombinant human IL-7 as the immunogen.</p>

<p>Tenomodulin antibody was raised using the N terminal of TNMD corresponding to a region with amino acids KKKIYMEIDPVTRTEIFRSGNGTDETLEVHDFKNGYTGIYFVGLQKCFIK</p>

<p>RALA antibody was raised in rabbit using the middle region of RALA as the immunogen</p>

<p>ZNF266 antibody was raised in rabbit using the N terminal of ZNF266 as the immunogen</p>

<p>CASP6 antibody was raised in rabbit using the middle region of CASP6 as the immunogen</p>

<p>SGK3 antibody was raised using the N terminal of SGK3 corresponding to a region with amino acids LYNHPDVRAFLQMDSPKHQSDPSEDEDERSSQKLHSTSQNINLGPSGNPH</p>

<p>MED4 antibody was raised in rabbit using the C terminal of MED4 as the immunogen</p>

<p>ZNF554 antibody was raised in rabbit using the N terminal of ZNF554 as the immunogen</p>

<p>UCHL5 antibody was raised in rabbit using the C terminal of UCHL5 as the immunogen</p>

<p>FAM53A antibody was raised in rabbit using the C terminal of FAM53A as the immunogen</p>

<p>ZNF675 antibody was raised in rabbit using the N terminal of ZNF675 as the immunogen</p>

<p>TMEM16K antibody was raised using the C terminal of TMEM16K corresponding to a region with amino acids LKADIDATLYEQVILEKEMGTYLGTFDDYLELFLQFGYVSLFSCVYPLAA</p>

<p>RNF128 antibody was raised in rabbit using the C terminal of RNF128 as the immunogen</p>

<p>MFNG antibody was raised using the middle region of MFNG corresponding to a region with amino acids MAPWASGSRFMDTSALIRLPDDCTMGYIIECKLGGRLQPSPLFHSHLETL</p>

<p>ZNF365 antibody was raised in rabbit using the N terminal of ZNF365 as the immunogen</p>

<p>The Synaptotagmin antibody is a highly effective medicament that belongs to the class of monoclonal antibodies. It is specifically designed to target and bind to synaptotagmin, a protein involved in neurotransmitter release at synapses. This antibody works by blocking the binding of synaptotagmin to its receptor proteins, thereby inhibiting synaptic transmission and reducing neuronal activity.</p>

<p>Lrp8 antibody was raised in rabbit using the middle region of Lrp8 as the immunogen</p>

<p>Usp10 antibody was raised in rabbit using the C terminal of Usp10 as the immunogen</p>

<p>SLC7A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LGFIMVSGFVKGSVKNWQLTEEDFGNTSGRLCLNNDTKEGKPGVGGFMPF</p>

<p>The AKR1C1 antibody is a potent family kinase inhibitor that targets specific growth factors, such as glucagon and epidermal growth factor. It is a polyclonal antibody that has been developed for neutralizing the effects of these growth factors in various biological systems. The antibody is formulated with excipients to ensure stability and efficacy. It can be used in various life science applications, including research and diagnostics. Additionally, the AKR1C1 antibody can also target other proteins, such as β-catenin, chemokines, alpha-fetoprotein, and globulins. Its specificity and effectiveness make it an essential tool for studying protein-protein interactions and cellular signaling pathways.</p>

<p>ALG1 antibody was raised using the N terminal of ALG1 corresponding to a region with amino acids VVLGDVGRSPRMQYHALSLAMHGFSVTLLGFCNSKPHDELLQNNRIQIVG</p>

<p>PIGZ antibody was raised using the N terminal of PIGZ corresponding to a region with amino acids VLWGGLSLLRVLWCLLPQTGYVHPDEFFQSPEVMAEDILGVQAARPWEFY</p>

<p>SERPINA4 antibody was raised in rabbit using the middle region of SERPINA4 as the immunogen</p>

<p>TIMP2 antibody was raised in rabbit using the middle region of TIMP2 as the immunogen</p>

<p>CDC23 antibody was raised using a synthetic peptide corresponding to a region with amino acids DTREEGKALLRQILQLRNQGETPTTEVPAPFFLPASLSANNTPTRRVSPL</p>

<p>Pnrc2 antibody was raised in rabbit using the N terminal of Pnrc2 as the immunogen</p>

<p>KCNC4 antibody was raised using the middle region of KCNC4 corresponding to a region with amino acids NIDRNVTEILRVGNITSVHFRREVETEPILTYIEGVCVLWFTLEFLVRIV</p>

<p>PTPRR antibody was raised using the C terminal of PTPRR corresponding to a region with amino acids NYTIRNLVLKQGSHTQHVKHYWYTSWPDHKTPDSAQPLLQLMLDVEEDRL</p>

<p>PLD3 antibody was raised using the N terminal of PLD3 corresponding to a region with amino acids WVLLVLILAVVGFGALMTQLFLWEYGDLHLFGPNQRPAPCYDPCEAVLVE</p>

SERPINE1 antibody was raised using the C terminal of SERPINE1 corresponding to a region with amino acids VNESGTVASSSTAVIVSARMAPEEIIMDRPFLFVVRHNPTGTVLFMGQVM

<p>SERPINB12 antibody was raised in rabbit using residues 260-275 [SHSKDNLKGLEELERK] of the human SERPINB12 protein as the immunogen.</p>

<p>KCNMA1 antibody was raised using the middle region of KCNMA1 corresponding to a region with amino acids CFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQFDHNAG</p>

<p>SLC25A25 antibody was raised using a synthetic peptide corresponding to a region with amino acids AVGLRRLGLHRTEGELQKIVQAGDKDLDGQLDFEEFVHYLQDHEKKLRLV</p>

<p>ATP6V1G2 antibody was raised in rabbit using the middle region of ATP6V1G2 as the immunogen</p>

<p>The Adrenomedullin antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that specifically targets adrenomedullin, a peptide hormone involved in various physiological processes. This antibody has been extensively tested and validated for its specificity and sensitivity in detecting adrenomedullin in human serum samples.</p>

<p>SLC26A9 antibody was raised using the middle region of SLC26A9 corresponding to a region with amino acids LAKLSSTYGKIGVKVFLVNIHAQVYNDISHGGVFEDGSLECKHVFPSIHD</p>

<p>ADCY2 antibody was raised in rabbit using the middle region of ADCY2 as the immunogen</p>

<p>HSF1 antibody was raised in rabbit using the C terminal of HSF1 as the immunogen</p>

<p>SLC17A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids YFCEYWLFYTIMAYTPTYISSVLQANLRDSGILSALPFVVGCICIILGGL</p>

<p>PEA15 antibody was raised in rabbit using the C terminal of PEA15 as the immunogen</p>

<p>C21orf66 antibody was raised in rabbit using the N terminal of C21ORF66 as the immunogen</p>

<p>ACOT11 antibody was raised using the middle region of ACOT11 corresponding to a region with amino acids AEKTRVESVELVLPPHANHQGNTFGGQIMAWMENVATIAASRLCRAHPTL</p>

<p>RAB40B antibody was raised using the middle region of RAB40B corresponding to a region with amino acids YAERLGVTFFEVSPLCNFNITESFTELARIVLLRHGMDRLWRPSKVLSLQ</p>

<p>SC5DL antibody was raised using a synthetic peptide corresponding to a region with amino acids NQVRREIKFTVQALPWISILTVALFLLEIRGYSKLHDDLGEFPYGLFELV</p>

<p>Purified Polyclonal AMPK beta 1 antibody</p>

<p>App antibody was raised in rabbit using the C terminal of App as the immunogen</p>

<p>ATP4B antibody was raised using the middle region of ATP4B corresponding to a region with amino acids QVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCK</p>

<p>Klotho antibody was raised using the middle region of KL corresponding to a region with amino acids HAQNGKISIALQADWIEPACPFSQKDKEVAERVLEFDIGWLAEPIFGSGD</p>

<p>IL17 antibody was raised in goat using highly pure recombinant hIL-17A as the immunogen.</p>

<p>C1D antibody was raised in rabbit using the middle region of C1D as the immunogen</p>

<p>Claudin 18 antibody was raised using the C terminal of CLDN18 corresponding to a region with amino acids PEETNYKAVSYHASGHSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDE</p>

<p>Purified Polyclonal EEF2K antibody</p>

MCP4 antibody was raised in goat using highly pure recombinant hMCP-4 (human MCP-4) as the immunogen.

Plexin A4 antibody was raised using the middle region of PLXNA4 corresponding to a region with amino acids TQEWIGVEGDPPGANIASQEQMLCVYLQCSSHKAISDQRVQPLLCCFLNV

<p>Presenilin 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VVVATIKSVRFYTEKNGQLIYTPFTEDTPSVGQRLLNSVLNTLIMISVIV</p>