Primary Antibodies

<p>ZNF385D antibody was raised in rabbit using the C terminal of ZNF385D as the immunogen</p>

<p>RBP4 antibody was raised using the N terminal of RBP4 corresponding to a region with amino acids MKWVWALLLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDP</p>

<p>WNT3A antibody was raised using the N terminal of WNT3A corresponding to a region with amino acids MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVP</p>

<p>CHST13 antibody was raised using a synthetic peptide corresponding to a region with amino acids CHPCRLRYDVVGKFETLAEDAAFVLGLAGASDLSFPGPPRPRGAAASRDL</p>

<p>ATP2B4 antibody was raised using the middle region of ATP2B4 corresponding to a region with amino acids FAGEKFFDIDSGRKAPLHSPPSQHYTIVFNTFVLMQLFNEINSRKIHGEK</p>

<p>DIRC2 antibody was raised using the middle region of DIRC2 corresponding to a region with amino acids  AAESSRAHIKDRIEAVLYAEFGVVCLIFSATLAYFPPRPPLPPSVAAASQ</p>

Granzyme A antibody was raised using a synthetic peptide corresponding to a region with amino acids TREGDLKLLQLTEKAKINKYVTILHLPKKGDDVKPGTMCQVAGWGRTHNS

<p>The HES6 antibody is a highly specialized antibody used in the field of Life Sciences. It is a polyclonal antibody that specifically targets and neutralizes HES6, a protein involved in various cellular processes. This antibody has been shown to be effective in blocking the activity of HES6, which plays a crucial role in regulating cell growth and differentiation.</p>

<p>NPFF2 antibody was raised in rabbit using N terminal sequence MNEKWDTNSSENWHPI and C terminal sequence ELVMEELKETTNSSEI of the human NPFF2 protein as the immunogen.</p>

<p>ZNF597 antibody was raised in rabbit using the middle region of ZNF597 as the immunogen</p>

<p>NYD-SP21 antibody was raised using the middle region of Nyd-Sp21 corresponding to a region with amino acids  QYPEGQSKDGQVKDQQTDKEQNSKKQTQDQQTEDQPAQEKKSPKGQFQNV</p>

<p>ZNF681 antibody was raised in rabbit using the N terminal of ZNF681 as the immunogen</p>

<p>Galnt3 antibody was raised in rabbit using the N terminal of Galnt3 as the immunogen</p>

<p>The ASK1 antibody is a highly specialized monoclonal antibody that targets the activated form of the apoptosis signal-regulating kinase 1 (ASK1) enzyme. This antibody is commonly used in research laboratories and the pharmaceutical industry for various applications in the field of life sciences.</p>

<p>The p53 antibody is a monoclonal antibody used in Life Sciences research. It has a spherical morphology and is specifically designed for the immunohistochemical detection of the carboxy terminal of the human p53 protein. Monoclonal antibodies are highly specific and bind to a single epitope on the target protein, ensuring accurate and reliable results. This p53 antibody can be used to study the expression and localization of p53 in various tissues and cell types. It is also commonly used to investigate diseases such as cutaneous systemic sclerosis, where abnormal p53 expression has been observed. The p53 antibody can be used in combination with other antibodies, such as polyclonal antibodies, to provide a comprehensive analysis of protein expression patterns. Its activation can trigger various cellular responses, including apoptosis, cell cycle arrest, and DNA repair mechanisms. By targeting the tetramerization domain of p53, this antibody can help researchers gain insights into its role in regulating critical cellular processes and its interactions with other proteins</p>

<p>Purified Polyclonal BAF53A antibody</p>

<p>PTPRH antibody was raised using the middle region of PTPRH corresponding to a region with amino acids QTKNSVMLWWKAPGDPHSQLYVYWVQWASKGHPRRGQDPQANWVNQTSRT</p>

<p>KIAA0319L antibody was raised using the middle region of KIAA0319L corresponding to a region with amino acids VTDTIGQQATAQVTVIVQPENNKPPQADAGPDKELTLPVDSTTLDGSKSS</p>

<p>Prrg3 antibody was raised in rabbit using the N terminal of Prrg3 as the immunogen</p>

<p>SLC25A42 antibody was raised using the N terminal of SLC25A42 corresponding to a region with amino acids  GNGVKEGPVRLHEDAEAVLSSSVSSKRDHRQVLSSLLPGALAGALAKTAV</p>

<p>Scyl3 antibody was raised in rabbit using the middle region of Scyl3 as the immunogen</p>

<p>TOLLIP antibody was raised using the C terminal of TOLLIP corresponding to a region with amino acids MATTVSTQRGPVYIGELPQDFLRITPTQQQRQVQLDAQAAQQLQYGGAVG</p>

<p>Capsl antibody was raised in rabbit using the C terminal of Capsl as the immunogen</p>

<p>PARP16 antibody was raised using a synthetic peptide corresponding to a region with amino acids PKYFVVTNNQLLRVKYLLVYSQKPPKSRASSQLSWFSSHWFTVMISLYLL</p>

<p>RDH16 antibody was raised using a synthetic peptide corresponding to a region with amino acids SKERFLKSFLEIWDRSSPEVKEAYGEKFVADYKKSAEQMEQKCTQDLSLV</p>

<p>CKLF antibody was raised using the N terminal of CKLF corresponding to a region with amino acids MDNVQPKIKHRPFCFSVKGHVKMLRLALTVTSMTFFIIAQAPEPYIVITG</p>

<p>Kcnt1 antibody was raised in rabbit using the C terminal of Kcnt1 as the immunogen</p>

<p>beta 2 Microglobulin antibody was raised using the N terminal of B2M corresponding to a region with amino acids MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGF</p>

<p>BASP1 antibody was raised in rabbit using the N terminal of BASP1 as the immunogen</p>

<p>The STAT5 antibody is a highly specific monoclonal antibody that is used in life sciences research. It specifically targets the STAT5 protein, which plays a crucial role in cellular signaling and gene expression. This antibody is widely used in various applications, including Western blotting, immunohistochemistry, and flow cytometry.</p>

<p>SLC44A3 antibody was raised using the N terminal of SLC44A3 corresponding to a region with amino acids MGYSVVAGAAGRLLFGYDSFGNMCGKKNSPVEGAPLSGQDMTLKKHVFFM</p>

<p>C12ORF53 antibody was raised using the middle region of C12Orf53 corresponding to a region with amino acids VWGPTVSREDGGDPNSANPGFLDYGFAAPHGLATPHPNSDSMRGDGDGLI</p>

<p>Anoctamin 6 antibody was raised using the middle region of ANO6 corresponding to a region with amino acids KSKGNPYSDLGNHTTCRYRDFRYPPGHPQEYKHNIYYWHVIAAKLAFIIV</p>

<p>Eif2c3 antibody was raised in rabbit using the N terminal of Eif2c3 as the immunogen</p>

<p>ZNF100 antibody was raised in rabbit using the N terminal of ZNF100 as the immunogen</p>

<p>Klotho antibody was raised using the middle region of KL corresponding to a region with amino acids HRGYSIRRGLFYVDFLSQDKMLLPKSSALFYQKLIEKNGFPPLPENQPLE</p>

<p>9330134C04Rik antibody was raised in rabbit using the C terminal of 9330134C04Rik as the immunogen</p>

<p>CSF1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPTTWLGSLLLLVCLLASRSITEEVSEYCSHMIGSGHLQSLQRLIDSQME</p>

<p>ARHGAP15 antibody was raised in rabbit using the middle region of ARHGAP15 as the immunogen</p>

<p>Itgb1 antibody was raised in rabbit using the C terminal of Itgb1 as the immunogen</p>

<p>RHBG antibody was raised using a synthetic peptide corresponding to a region with amino acids RYNHKTDAALWHRSNHSNADNEFYFRYPSFQDVHAMVFVGFGFLMVFLQR</p>

<p>The CSK antibody is a highly reactive and neutralizing antibody that targets the activated form of calmodulin. This polyclonal antibody is widely used in life sciences research, particularly in studies related to growth factors and adipose tissue. It has also been shown to have a neutralizing effect on influenza hemagglutinin, making it a valuable tool for studying viral infections. The CSK antibody is available as both polyclonal and monoclonal antibodies, providing researchers with options for their specific experimental needs. With its ability to inhibit the activity of calmodulin-dependent enzymes such as 3-kinase and solute diuretic, this antibody offers great potential for further understanding cellular signaling pathways.</p>

<p>KCNK1 antibody was raised using the middle region of KCNK1 corresponding to a region with amino acids EDQVHIIEHDQLSFSSITDQAAGMKEDQKQNEPFVATQSSACVDGPANH</p>

<p>F8 antibody was raised in rabbit using the C terminal of F8 as the immunogen</p>

<p>ETR3 antibody was raised in rabbit using C terminal sequence [VQLKRSKNDSKPYC] of human and mouse ETR-3 as the immunogen.</p>

<p>WHSC1 antibody was raised in rabbit using the N terminal of WHSC1 as the immunogen</p>

<p>PLA2G5 antibody was raised using the N terminal of PLA2G5 corresponding to a region with amino acids MKGLLPLAWFLACSVPAVQGGLLDLKSMIEKVTGKNALTNYGFYGCYCGW</p>

<p>RPAIN antibody was raised in rabbit using the C terminal of RPAIN as the immunogen</p>

<p>Growth Hormone 2 antibody was raised using the middle region of GH2 corresponding to a region with amino acids LEEGIQTLIGWKMAAPGLGRSSISPTASLTQNRTTMTHCSRTTGCSTASG</p>

<p>Ahi1 antibody was raised in rabbit using the C terminal of Ahi1 as the immunogen</p>

<p>ILF3 antibody was raised using the N terminal of ILF3 corresponding to a region with amino acids PTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDD</p>

<p>ENOX2 antibody was raised in rabbit using the N terminal of ENOX2 as the immunogen</p>

<p>LTA4H antibody was raised in rabbit using the N terminal of LTA4H as the immunogen</p>

<p>Purified Polyclonal ABCD1 antibody</p>

<p>TIE1 antibody was raised in rabbit using a 21 amino acid peptide of human TIE1 conjugated to KLH.</p>

<p>SEMA3D antibody was raised using the middle region of SEMA3D corresponding to a region with amino acids LECIPKSQQATIKWYIQRSGDEHREELKPDERIIKTEYGLLIRSLQKKDS</p>

<p>GLUT10 antibody was raised in rabbit using residues 367-385 (ILSTAKKTKPHPRSGDPSA) of the human, mouse and rat GLUT10 protein as the immunogen.</p>

<p>KIF5B antibody was raised using the C terminal of KIF5B corresponding to a region with amino acids ANEVKQAVEQQIQSHRETHQKQISSLRDEVEAKAKLITDLQDQNQKMMLE</p>

<p>ENDOG antibody was raised using the middle region of ENDOG corresponding to a region with amino acids YVMPNAPVDEAIPLERFLVPIESIERASGLLFVPNILARAGSLKAITAGS</p>

<p>RAD17 antibody was raised in rabbit using residues 10-23 [STKRSLKKKKIRKI] of the S. pombe RAD17 75 kDA protein as the immunogen.</p>

<p>XPNPEP3 antibody was raised in rabbit using the N terminal of XPNPEP3 as the immunogen</p>

<p>KCNS1 antibody was raised in rabbit using the N terminal of KCNS1 as the immunogen</p>

<p>ALDH3A1 antibody was raised in rabbit using the C terminal of ALDH3A1 as the immunogen</p>

<p>ZNF226 antibody was raised in rabbit using the middle region of ZNF226 as the immunogen</p>

<p>GDF15 antibody was raised using the N terminal of GDF15 corresponding to a region with amino acids ASRASFPGPSELHSEDSRFRELRKRYEDLLTRLRANQSWEDSNTDLVPAP</p>

<p>Septin 2 antibody was raised using the middle region of 40423 corresponding to a region with amino acids LQEVTQDLHYENFRSERLKRGGRKVENEDMNKDQILLEKEAELRRMQEMI</p>

<p>SAA4 antibody was raised using the middle region of SAA4 corresponding to a region with amino acids AAKLISRSRVYLQGLIDYYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRF</p>

<p>Calreticulin 3 antibody was raised using the N terminal of CALR3 corresponding to a region with amino acids MAGPQQQPPYLHLAELTASQFLEIWKHFDADGNGYIEGKELENFFQELEK</p>

<p>FEM1B antibody was raised using a synthetic peptide corresponding to a region with amino acids DKSTTGVSEILLKTQMKMSLKCLAARAVRANDINYQDQIPRTLEEFVGFH</p>

<p>ZNF322A antibody was raised in rabbit using the C terminal of ZNF322A as the immunogen</p>

<p>Zfp90 antibody was raised in rabbit using the N terminal of Zfp90 as the immunogen</p>

<p>Tetraspanin 10 antibody was raised using the N terminal of TSPAN10 corresponding to a region with amino acids SCVKYLIFLSNFPFSLLGLLALAIGLWGLAVKGSLGSDLGGPLPADPMLG</p>

<p>TNF alpha antibody was raised in rabbit using highly pure recombinant murine TNF-alpha as the immunogen.</p>

<p>PARP10 antibody was raised in rabbit using the N terminal of PARP10 as the immunogen</p>

<p>BAD antibody was raised in rabbit using the C terminal of BAD as the immunogen</p>

<p>PI16 antibody was raised using the middle region of PI16 corresponding to a region with amino acids SKSLPNFPNTSATANATGGRALALQSSLPGAEGPDKPSVVSGLNSGPGHV</p>

<p>ACBD5 antibody was raised using the C terminal of ACBD5 corresponding to a region with amino acids VRRGRGHRMQHLSEGTKGRQVGSGGDGERWGSDRGSRGSLNEQIALVLMR</p>

<p>DRGX antibody was raised in rabbit using the middle region of DRGX as the immunogen</p>

<p>USP15 antibody was raised in rabbit using the C terminal of USP15 as the immunogen</p>

<p>XPO5 antibody was raised in rabbit using the middle region of XPO5 as the immunogen</p>

<p>MIP1 alpha antibody was raised in rabbit using highly pure recombinant murine MIP-1a as the immunogen.</p>

<p>PLCD1 antibody was raised using the N terminal of PLCD1 corresponding to a region with amino acids DIQEVRMGHRTEGLEKFARDVPEDRCFSIVFKDQRNTLDLIAPSPADAQH</p>

<p>OR1D2 antibody was raised in rabbit using the C terminal of OR1D2 as the immunogen</p>

<p>OLIG3 antibody was raised in rabbit using the N terminal of OLIG3 as the immunogen</p>

<p>MSH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GNKASKENDWYLAYKASPGNLSQFEDILFGNNDMSASIGVVGVKMSAVDG</p>

<p>The APJ antibody is a highly versatile and effective tool used in Life Sciences research. This colloidal antibody is designed to specifically target and bind to the APJ protein, a key regulator in various cellular processes. The APJ antibody is commonly used in studies involving biomolecules, such as epidermal growth factor and growth factors, to investigate their interactions and signaling pathways.</p>

<p>ZC3H7A antibody was raised in rabbit using the middle region of ZC3H7A as the immunogen</p>

<p>IL6 antibody was raised in rabbit using highly pure recombinant hIL-6 as the immunogen.</p>

<p>FUCA1 antibody was raised using the middle region of FUCA1 corresponding to a region with amino acids TNWPSPVSWNWNSKDVGPHRDLVGELGTALRKRNIRYGLYHSLLEWFHPL</p>

<p>BBC3 antibody was raised in rabbit using the N terminal of BBC3 as the immunogen</p>

<p>FOXR1 antibody was raised in rabbit using the N terminal of FOXR1 as the immunogen</p>

<p>Purified Polyclonal FOXC1/2 antibody</p>

<p>DGAT2L4 antibody was raised using the C terminal of DGAT2L4 corresponding to a region with amino acids GEPLPMPKIENPSQEIVAKYHTLYIDALRKLFDQHKTKFGISETQELEII</p>

<p>Vwa5a antibody was raised in rabbit using the C terminal of Vwa5a as the immunogen</p>

<p>ZDHHC19 antibody was raised using the N terminal of ZDHHC19 corresponding to a region with amino acids TLLTDATPLVKEPHPLPLVPRPWFLPSLFAAFNVVLLVFFSGLFFAFPCR</p>

<p>DMRTC2 antibody was raised in rabbit using the N terminal of DMRTC2 as the immunogen</p>

<p>IMP5 antibody was raised using the middle region of IMP5 corresponding to a region with amino acids NPGEDTTEIVTISENEATNPEDRSDSSEGWSDAHLDPNELPFIPPGASEE</p>

<p>PRKAR1A antibody was raised in rabbit using the C terminal of PRKAR1A as the immunogen</p>

<p>SLC40A1 antibody was raised in rabbit using the middle region of SLC40A1 as the immunogen</p>

<p>NPAL2 antibody was raised using the N terminal of NPAL2 corresponding to a region with amino acids AAVAPAGPGDSASAALDELSLNFTYGAPGAGNGSLSGDWYRRNQIHLFGV</p>