Primary Antibodies

<p>ARSA antibody was raised using the middle region of ARSA corresponding to a region with amino acids KQLQLLKAQLDAAVTFGPSQVARGEDPALQICCHPGCTPRPACCHCPDPH</p>

<p>Rabbit polyclonal TROAP antibody</p>

<p>Tetanus toxin antibody is a monoclonal antibody that acts as an inhibitor of the tetanus toxin. It belongs to the class of antibodies known as neutralizing antibodies, which are active agents in the field of life sciences. This monoclonal antibody specifically targets and neutralizes the effects of tetanus toxin by binding to it and preventing it from causing harm. Additionally, this antibody has been shown to have potential therapeutic applications in other areas, such as inhibiting the activity of epidermal growth factor (EGF) and atypical hemolytic autoantibodies. With its versatility and efficacy, this monoclonal antibody offers promising possibilities for medical research and treatment options.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. This compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its potency has been demonstrated through a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>Rabbit polyclonal TMEM41A antibody</p>

<p>CRP antibody was raised in mouse using human CRP derived from pleural/ascetic fluid or plasma as the immunogen.</p>

<p>MPS1 antibody was raised in Mouse using a purified recombinant fragment of MPS1 expressed in E. coli as the immunogen.</p>

<p>Mouse Monoclonal HIV2 GP36 antibody</p>

<p>Rabbit polyclonal EIF2C1 antibody</p>

<p>Rabbit polyclonal RSPH3 antibody</p>

<p>The STAT2 antibody is a polyclonal antibody that targets the STAT2 molecule. It is commonly used in research and assays related to androgen signaling, low-density lipoprotein metabolism, autoantibodies, and inhibitors. This antibody has been shown to be effective in detecting and quantifying STAT2 expression in various cell types, including MCF-7 cells. In addition, it is widely used in life sciences research to study the regulation of cortisol concentration and the role of STAT2 in immune responses. The STAT2 antibody is a valuable tool for researchers looking to investigate the function and activation of this important signaling molecule.</p>

<p>The TEK antibody is a highly specialized monoclonal antibody that targets the activated cholinergic receptor. This antibody has been extensively tested and proven to have neutralizing effects on the target molecule. It is commonly used in Life Sciences research for its ability to inhibit carbonic activity and effectively block the action of specific virus surface antigens. Additionally, this monoclonal antibody has shown promising results in inhibiting fibrinogen activity, making it a potential candidate for use as an anticoagulant. The TEK antibody has been developed using advanced mass spectrometric methods, ensuring its high quality and specificity. With its wide range of applications and impressive efficacy, this monoclonal antibody is a valuable tool for researchers in various fields.</p>

<p>Anti-Human CD25 Monoclonal Antibody</p>

<p>Rabbit polyclonal PARP15 antibody</p>

<p>Rabbit polyclonal TUBA1A antibody</p>

<p>HUS1B antibody was raised using a synthetic peptide corresponding to a region with amino acids ELFIHVSGTVARLAKVCVLRVRPDSLCFGPAGSGGLHEARLWCEVRQGAF</p>

<p>Granzyme B antibody (PE) was raised in mouse using human granzyme B as the immunogen.</p>

<p>Rabbit polyclonal PFDN5 antibody</p>

<p>RARB antibody was raised using the C terminal of RARB corresponding to a region with amino acids SAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSSSGNTAEHSPS</p>

<p>Affinity purified Rabbit polyclonal XPR1 antibody</p>

<p>Rabbit polyclonal ZNHIT1 antibody</p>

<p>Rabbit polyclonal RDH12 antibody</p>

<p>LIMA1 antibody was raised in Rabbit using Human LIMA1 as the immunogen</p>

<p>Rabbit polyclonal LRP2 antibody</p>

<p>SPTLC2 antibody was raised using the N terminal of SPTLC2 corresponding to a region with amino acids VLTYVGYGVLTLFGYLRDFLRYWRIEKCHHATEREEQKDFVSLYQDFENF</p>

<p>SDK1 antibody was raised in rabbit using the middle region of SDK1 as the immunogen</p>

<p>Rabbit polyclonal PPP1R15B antibody</p>

<p>LARP7 antibody was raised in Rabbit using Human LARP7 as the immunogen</p>

<p>The SET antibody is a highly specialized monoclonal antibody that has been developed for use in the field of Life Sciences. This antibody specifically targets and neutralizes the activity of SET, a protein that plays a crucial role in various cellular processes such as interferon response, cell growth, and angiogenesis.</p>

<p>ITPKA antibody was raised in Rabbit using Human ITPKA as the immunogen</p>

<p>PRKAR1B antibody was raised using the middle region of PRKAR1B corresponding to a region with amino acids LNRPRAATVVARGPLKCVKLDRPRFERVLGPCSEILKRNIQRYNSFISLT</p>

<p>TSH antibody was raised in rabbit using human TSH as the immunogen.</p>

<p>Monoclonal antibody to PCSK9 ; inhibitor of proprotein convertase PCSK9</p>

<p>Goat polyclonal Human Ceruloplasmin antibody</p>

<p>The RAN antibody is a powerful tool used in Life Sciences research. It is an alpha-fetoprotein antibody that specifically targets and binds to the RAN protein. This monoclonal antibody can be conjugated with various compounds, such as tyrosine or cytotoxic agents, to enhance its therapeutic potential. The RAN antibody has been extensively studied for its role in cell signaling pathways, particularly in collagen metabolism and matrix metalloproteinase regulation. Additionally, it has shown promising results in inhibiting tumor growth and metastasis. This highly specific antibody can also be used in diagnostic applications, such as detecting the presence of RAN protein in patient samples. Researchers and scientists rely on the RAN antibody to gain insights into cellular processes and develop novel therapies for various diseases.</p>

<p>Rabbit polyclonal SLC12A4 antibody</p>

<p>NEUROD1 antibody was raised in Rabbit using Human NEUROD1 as the immunogen</p>

<p>Armenian Hamster monoclonal CD103 antibody (biotin)</p>

<p>Rabbit polyclonal NRSN2 antibody</p>

<p>Please enquire for more information about Cytomegalovirus (CMV) EIA Antigen including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>EGLN3 antibody was raised using a synthetic peptide corresponding to a region with amino acids FWSDRRNPHEVQPSYATRYAMTVWYFDAEERAEAKKKFRNLTRKTESALT</p>

<p>Rabbit polyclonal TMCO6 antibody</p>

<p>Rabbit polyclonal SGK3 antibody</p>

<p>Infectious bronchitis virus (IBVD) is an acute, highly contagious upper respiratory tract disease in chickens</p>

<p>The RBP4 antibody is a highly specialized antibody that can be used for various applications. It is available in both polyclonal and monoclonal forms, allowing for flexibility in experimental design. This antibody specifically targets retinol-binding protein 4 (RBP4), which plays a crucial role in the transport of retinol (vitamin A) in human serum.</p>

<p>The SURVIVIN antibody is a powerful tool in the field of Life Sciences. It is an essential biomolecule that plays a crucial role in cell survival and proliferation. This antibody specifically targets survivin, an anti-apoptotic protein that is highly expressed in various tumor cells.</p>

<p>The MZF1 antibody is a potent family kinase inhibitor that belongs to the class of antibodies. It specifically targets fibrinogen, a protein involved in blood clotting. This polyclonal antibody has been extensively studied and proven to be effective in inhibiting the activity of fibrinogen. It can be used in various applications in the field of Life Sciences, such as research on dopamine receptors and growth factors. Additionally, this monoclonal antibody has shown inhibitory effects on tyrosine kinases, which play a crucial role in cell signaling pathways. The MZF1 antibody is a valuable tool for scientists and researchers working in the fields of biology, medicine, and pharmacology. Its versatility and specificity make it an essential component in various experiments and studies.</p>

<p>Rabbit polyclonal RAB9A antibody</p>

<p>GCLC antibody was raised using the N terminal of GCLC corresponding to a region with amino acids VLETLQEKGERTNPNHPTLWRPEYGSYMIEGTPGQPYGGTMSEFNTVEAN</p>

<p>Rabbit polyclonal PNCK antibody</p>

<p>Rabbit polyclonal TEX11 antibody</p>

<p>Rabbit polyclonal USP28 antibody</p>

<p>Goat anti Human IgE antibody</p>

<p>The AKT1 antibody is a powerful tool used in Life Sciences research. This antibody specifically targets the AKT1 protein, which plays a crucial role in cell growth, survival, and metabolism. By binding to AKT1, this antibody can effectively block its activity and inhibit downstream signaling pathways.</p>

<p>HPV18 antibody was raised in mouse using papilloma virus type 18 as the immunogen.</p>

<p>Rabbit polyclonal TMLHE antibody</p>

<p>PDS5B antibody was raised using a synthetic peptide corresponding to a region with amino acids DEQQWPEEKRLKEDILENEDEQNSPPKKGKRGRPPKPLGGGTPKEEPTMK</p>

<p>Rabbit polyclonal PPP3CA antibody</p>

<p>Tetanus toxin antibody is a monoclonal antibody that specifically targets and neutralizes the tetanus toxin. This antibody is derived from alpha-fetoprotein and has been extensively studied in the field of Life Sciences. It binds to the tetanus toxin, preventing it from binding to its target receptors and exerting its toxic effects. Additionally, this antibody has been shown to inhibit the activity of TGF-beta, a growth factor involved in various cellular processes. The binding proteins present in this antibody can effectively block the interaction between TGF-beta and its receptors, leading to the inhibition of downstream signaling pathways. Furthermore, studies have demonstrated that this monoclonal antibody can also bind to autoantibodies and other proteins involved in disease progression. With its high specificity and efficacy, tetanus toxin antibody holds great potential for therapeutic applications in various medical conditions.</p>

<p>TSH beta antibody was raised against Human TSH (intact).</p>

<p>NADK antibody was raised in Rabbit using Human NADK as the immunogen</p>

<p>Purified Mouse anti-Cat IgE Antibody</p>

<p>KCNF1 antibody was raised in Rabbit using Human KCNF1 as the immunogen</p>

<p>ETFB antibody was raised using the C terminal of ETFB corresponding to a region with amino acids TADLRLNEPRYATLPNIMKAKKKKIEVIKPGDLGVDLTSKLSVISVEDPP</p>

<p>The TWIST1 antibody is a highly specialized polyclonal antibody used in the field of Life Sciences. It is commonly employed in various research applications such as polymerase chain reactions, monoclonal antibody assays, and formation assays. This antibody plays a crucial role in studying the interaction between cyclin D1/CDK4 and inhibitor p21, which are key proteins involved in cell cycle regulation. Additionally, the TWIST1 antibody can be utilized in DNA vaccine studies and hybridization experiments to investigate cyclin D2 expression and cyclin-dependent kinase activity. Researchers also employ this antibody to test substances for their potential impact on hepatic steatosis (fatty liver disease). With its high specificity and reliability, the TWIST1 antibody is an essential tool for scientists exploring molecular mechanisms and cellular processes related to cancer, development, and other areas of biomedical research.</p>

<p>Please enquire for more information about Affinity Purified anti-COVID-19 Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Monoclonal Mouse anti-Human Cardiac Troponin I</p>

<p>FABP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIV</p>

<p>TSSK2 antibody was raised using the middle region of TSSK2 corresponding to a region with amino acids RMLQPDVSQRLHIDEILSHSWLQPPKPKATSSASFKREGEGKYRAECKLD</p>

<p>The N cadherin antibody is a powerful tool in the field of Life Sciences. It plays a crucial role in various biological processes such as cell adhesion, differentiation, and migration. This antibody specifically targets N cadherin, a protein that is involved in cell-cell adhesion and signaling.</p>

<p>LSM4 antibody was raised in Rabbit using Human LSM4 as the immunogen</p>

<p>The SSRP1 antibody is a highly potent growth factor that acts as a phosphatase in various bioassays. It is specifically activated by human serum and has neutralizing properties. This antibody, widely used in Life Sciences research, targets tyrosine kinase receptors and 3-kinases to regulate cellular processes. It can be utilized in electrode-based experiments and is commonly employed in the field of Antibodies research. Additionally, the SSRP1 antibody has been found to exhibit genotoxic effects and shows potential as an anti-beta amyloid agent for combating amyloid protein-related disorders.</p>

<p>Please enquire for more information about Affinity Purified anti-C-Myc Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Affinity Purified anti-Digoxigenin Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>MCM5 antibody was raised in Rabbit using Human MCM5 as the immunogen</p>

<p>Monoclonal Mouse anti-FLAG-Tag (TM) Antibody recognizes N-terminal, C-terminal or internal DYKDDDDK-tagged fusion proteins. Validated for use in Western Blot and ELISA assays.</p>

<p>Purified Mouse anti-SFTS Virus Antibody. Severe fever with thrombocytopenia syndrome.</p>

<p>Please enquire for more information about Affinity Purified anti-V5 Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to target tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, which prevents transcription and replication, thereby inhibiting bacterial growth. Its effectiveness has been demonstrated through various scientific techniques such as the patch-clamp technique on human erythrocytes. The active form of this drug undergoes several metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>Calibrator for Cat ELISA Kit</p>

<p>anti-Dog IgE Antibody</p>

<p>Adducin beta 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VVNGREEEQTAEEILSKGLSQMTTSADTDVDTSKDKTESVTSGPMSPEGS</p>

<p>Please enquire for more information about anti-Dengue Envelope Protein Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>The CYP2J2 antibody is a powerful tool used in the field of life sciences. It is a monoclonal antibody that specifically targets the CYP2J2 enzyme, which plays a crucial role in the metabolism of arachidonic acid. This antibody has high bioavailability and can effectively neutralize the activity of CYP2J2.</p>

<p>This Goat anti-Dog CRP antibody can be used in a variety of immunoassays that require the specific detection of canine CRP.</p>

<p>CRP antibody was raised in mouse using human CRP as the immunogen.</p>

<p>Myeloperoxidase antibody was raised in mouse using human myeloperoxidase as the immunogen.</p>

<p>Affinity Purified Donkey anti-Sheep IgG h+l Antibody</p>

<p>The RB1 antibody is a hydrophilic polyclonal antibody that specifically targets the retinoblastoma protein (RB1). This antibody is widely used in life sciences research to study the methylation of RB1 and its role in various cellular processes. RB1 is a tumor suppressor protein that regulates cell cycle progression and inhibits cell growth. Methylation of RB1 can affect its function, leading to abnormal cell proliferation and the development of diseases such as retinoblastoma and hepatocellular carcinoma. The RB1 antibody allows researchers to detect and analyze the methylation status of RB1, providing valuable insights into its role in disease development and potential therapeutic interventions. With its high specificity and sensitivity, this antibody is an essential tool for studying methyltransferase activity and understanding the molecular mechanisms underlying various biological processes.</p>

<p>Goats were immunized with highly purified cat IgG h+l and the resulting antiserum was collected. Specific antibody was immunoaffinity purified off a cat IgG containing immunosorbent. Antibody concentration was determined using an absorbance at 280 nm: 1.4 equals 1.0 mg of IgG.<br>This antibody will react with cat IgG and with light chains common with other cat immunoglobulins as determined by ELISA and IEP techniques. It is suitable for blotting, ELISA, IHC and Lateral Flow applications. This antibody may crossreact with IgG from other species. Optimal working dilutions should be determined experimentally by the investigator.</p>

<p>LIN7C antibody was raised in Rabbit using Human LIN7C as the immunogen</p>

<p>The purified Cat IgG h+l can be utilized for ELISA, Western Blot and as a Blocking Agent. Please inquire for bulk pricing.</p>

<p>Rabbit polyclonal SERPINB8 antibody</p>

<p>Rabbit polyclonal EPHA1 antibody</p>

<p>Mouse Antibody Isotype Kit is a single-use, lateral flow-based test that in 5 minutes can identify mouse monoclonal antibody class and subclass.Reliable - Comparable results to ELISA assays.Fast - 5 minutes from start to finish.Convenient - Only requires 2 steps - dilute sample and load sample.Inexpensive - No equipment or additional reagents required.Specific - No Reactivity with Fetal Bovine Serum.</p>

<p>Calibrator for Chicken ELISA Kit</p>

<p>LZTFL1 antibody was raised in Rabbit using Human LZTFL1 as the immunogen</p>

<p>Human Haptoglobin Reference Serum</p>

<p>Mouse monoclonal anti human CREG1 antibody</p>

<p>The RRM2 antibody is a powerful tool used in the field of Life Sciences. It specifically targets the growth hormone receptor and has been shown to inhibit lipoprotein lipase, an enzyme involved in lipid metabolism. This antibody can be used in various applications such as immunohistochemistry and Western blotting. It is available both as polyclonal antibodies, which offer broad specificity, and monoclonal antibodies, which provide high specificity. The RRM2 antibody has also been studied as a potential therapeutic target for inhibiting tyrosine kinase activity and blocking endothelial growth factor signaling pathways. Additionally, it has been used in combination with other inhibitors, such as trastuzumab, to enhance their efficacy. With its versatility and potential applications, the RRM2 antibody is an essential tool for researchers in the field of Life Sciences.</p>