Primary Antibodies

<p>Mouse monoclonal HIV1 gp41 antibody (biotin); Neat Serum with no preservatives.</p>

<p>PTH antibody was raised in goat using human PTH as the immunogen.</p>

<p>NOB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TEIRDKATRRRLAVLPYELRFKEPLPEYVRLVTEFSKKTGDYPSLSATDI</p>

<p>Calibrator for Cat ELISA Kit</p>

<p>The N cadherin antibody is a powerful tool in the field of Life Sciences. It plays a crucial role in various biological processes such as cell adhesion, differentiation, and migration. This antibody specifically targets N cadherin, a protein that is involved in cell-cell adhesion and signaling.</p>

<p>MRPL37 antibody was raised in Rabbit using Human MRPL37 as the immunogen</p>

<p>GPR87 antibody was raised using the N terminal of GPR87 corresponding to a region with amino acids MGFNLTLAKLPNNELHGQESHNSGNRSDGPGKNTTLHNEFDTIVLPVLYL</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. This compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its potency has been demonstrated through a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>Rabbit polyclonal PIH1D1 antibody</p>

<p>Tetanus toxin antibody is a monoclonal antibody that specifically targets and neutralizes the tetanus toxin. This antibody is derived from alpha-fetoprotein and has been extensively studied in the field of Life Sciences. It binds to the tetanus toxin, preventing it from binding to its target receptors and exerting its toxic effects. Additionally, this antibody has been shown to inhibit the activity of TGF-beta, a growth factor involved in various cellular processes. The binding proteins present in this antibody can effectively block the interaction between TGF-beta and its receptors, leading to the inhibition of downstream signaling pathways. Furthermore, studies have demonstrated that this monoclonal antibody can also bind to autoantibodies and other proteins involved in disease progression. With its high specificity and efficacy, tetanus toxin antibody holds great potential for therapeutic applications in various medical conditions.</p>

<p>RARB antibody was raised using the C terminal of RARB corresponding to a region with amino acids SAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSSSGNTAEHSPS</p>

<p>Rabbit polyclonal RDH12 antibody</p>

<p>Affinity Purified Donkey anti-Sheep IgG h+l Antibody</p>

<p>SPTLC2 antibody was raised using the N terminal of SPTLC2 corresponding to a region with amino acids VLTYVGYGVLTLFGYLRDFLRYWRIEKCHHATEREEQKDFVSLYQDFENF</p>

<p>The RB1 antibody is a hydrophilic polyclonal antibody that specifically targets the retinoblastoma protein (RB1). This antibody is widely used in life sciences research to study the methylation of RB1 and its role in various cellular processes. RB1 is a tumor suppressor protein that regulates cell cycle progression and inhibits cell growth. Methylation of RB1 can affect its function, leading to abnormal cell proliferation and the development of diseases such as retinoblastoma and hepatocellular carcinoma. The RB1 antibody allows researchers to detect and analyze the methylation status of RB1, providing valuable insights into its role in disease development and potential therapeutic interventions. With its high specificity and sensitivity, this antibody is an essential tool for studying methyltransferase activity and understanding the molecular mechanisms underlying various biological processes.</p>

<p>Rabbit polyclonal PTK6 antibody</p>

<p>Goat polyclonal Human Ceruloplasmin antibody</p>

<p>Purified Mouse anti-Cat IgE Antibody</p>

<p>Please enquire for more information about anti-Dengue Envelope Protein Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ACTL7B antibody was raised using the middle region of ACTL7B corresponding to a region with amino acids KLITIGQERFRCSEMLFQPSLAGSTQPGLPELTAACLGRCQDTGFKEEMA</p>

<p>C5ORF39 antibody was raised using the N terminal Of C5Orf39 corresponding to a region with amino acids EQHFLGCVKRAWDSAEVAPEPQPPPIVSSEDRGPWPLPLYPVLGEYSLDS</p>

<p>MPS1 antibody was raised in Mouse using a purified recombinant fragment of MPS1 expressed in E. coli as the immunogen.</p>

<p>The STAT6 antibody is a specific antibody that binds to the receptor of STAT6, a growth factor involved in various cellular processes. This antibody is designed to recognize and bind to the specific disulfide bond on the STAT6 receptor, blocking its activity and preventing downstream signaling. The STAT6 antibody is a monoclonal antibody derived from human protein and has been extensively tested for its efficacy and specificity. It forms dimers with other antibodies, such as afatinib, to enhance its cytotoxic effects. In Life Sciences research, the STAT6 antibody is commonly used for immunohistochemistry, Western blotting, and hybridization studies. It can also be used in diagnostic applications to detect the presence of alpha-msh or other related proteins. Additionally, polyclonal antibodies can be generated using the STAT6 antibody as an antigen for immunization. These polyclonal antibodies are valuable tools for studying the role of STAT6 in various biological processes.</p>

<p>This Goat anti-Dog CRP antibody can be used in a variety of immunoassays that require the specific detection of canine CRP.</p>

<p>KCNG1 antibody was raised using the N terminal of KCNG1 corresponding to a region with amino acids MTLLPGDNSDYDYSALSCTSDASFHPAFLPQRQAIKGAFYRRAQRLRPQD</p>

<p>Goats were immunized with highly purified cat IgG h+l and the resulting antiserum was collected. Specific antibody was immunoaffinity purified off a cat IgG containing immunosorbent. Antibody concentration was determined using an absorbance at 280 nm: 1.4 equals 1.0 mg of IgG.<br>This antibody will react with cat IgG and with light chains common with other cat immunoglobulins as determined by ELISA and IEP techniques. It is suitable for blotting, ELISA, IHC and Lateral Flow applications. This antibody may crossreact with IgG from other species. Optimal working dilutions should be determined experimentally by the investigator.</p>