Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,709 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(738 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75327 products of "Primary Antibodies"
ITCH antibody
The ITCH antibody is a powerful tool in the field of immunology and cancer research. It is a polyclonal antibody that specifically targets the ITCH protein, which plays a crucial role in various cellular processes. The ITCH antibody has been extensively studied for its ability to inhibit the activity of carbonyl reductase, an enzyme involved in drug metabolism.
PM20D1 antibody
The PM20D1 antibody is a specific antibody that targets the PM20D1 antigen. It is commonly used in Life Sciences research to study the role of PM20D1 in various biological processes. This antibody is particularly useful as a serum marker for detecting the presence of PM20D1 in biological samples. It can be used in techniques such as immunohistochemistry and Western blotting to visualize and quantify the expression of PM20D1. Additionally, this antibody can be used as a tool to investigate the potential therapeutic applications of PM20D1 inhibitors or as a diagnostic tool for detecting autoantibodies against PM20D1. Its high specificity and sensitivity make it an essential component in many research studies related to dopamine metabolism, zinc chelation, fetal hemoglobin regulation, and other areas of interest in the field of Life Sciences.
Nucleolin antibody
Nucleolin antibody was raised using the N terminal of NCL corresponding to a region with amino acids GKALVATPGKKGAAIPAKGAKNGKNAKKEDSDEEEDDDSEEDEEDDEDED
HIV1 gp41 antibody (biotin)
Mouse monoclonal HIV1 gp41 antibody (biotin); Neat Serum with no preservatives.
TIE2 antibody
The TIE2 antibody is a highly specialized polyclonal antibody used in the field of Life Sciences. It is specifically designed for research purposes and is widely used in various applications such as immunohistochemistry, Western blotting, and flow cytometry.
Cip1 antibody
Cip1 antibody was raised in rabbit using residues 139-164 of the p21 protein as the immunogen.
Purity:Min. 95%Thrombin antibody
Thrombin antibody was raised in sheep using Thrombin prepared from purified rabbit Prothrombin as the immunogen.
Purity:Min. 95%Ctp Synthase antibody
Ctp Synthase antibody was raised using the N terminal of CTPS corresponding to a region with amino acids SMPFIEAFRQFQFKVKRENFCNIHVSLVPQPSSTGEQKTKPTQNSVRELR
AKT1 antibody
The AKT1 antibody is a powerful tool used in Life Sciences research. This antibody specifically targets the AKT1 protein, which plays a crucial role in cell growth, survival, and metabolism. By binding to AKT1, this antibody can effectively block its activity and inhibit downstream signaling pathways.
Purity:Min. 95%CD11c antibody
CD11c antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Purity:Min. 95%BCL7A antibody
BCL7A antibody was raised using the middle region of BCL7A corresponding to a region with amino acids CGSEVTTPENSSSPGMMDMHDDNSNQSSIADASPIKQENSSNSSPAPEPN
IL17 antibody
The IL17 antibody is a powerful medicament that plays a crucial role in neutralizing the effects of interleukin-17 (IL-17). This antibody is highly effective in targeting and binding to IL-17, thereby inhibiting its activity. IL-17 is a key player in various inflammatory conditions such as collagen-induced arthritis and cytotoxic T lymphocyte-mediated tissue damage. By blocking the action of IL-17, this antibody helps reduce inflammation and prevents tissue damage caused by excessive immune responses. The IL17 antibody is widely used in Life Sciences research and has proven to be an invaluable tool for studying the role of IL-17 in various disease models. Whether you're conducting experiments or developing therapies, this monoclonal antibody provides reliable results and consistent performance. Trust in the power of antibodies with our high-quality IL17 antibody.
TDG antibody
The TDG antibody is a highly specific monoclonal antibody that targets the glycan structures on glycoproteins. It is widely used in life sciences research to study the role of glycans in various biological processes. The TDG antibody can be used for applications such as lectin blotting, glycan profiling, and immunohistochemistry. This antibody recognizes a polymorphic epitope that is activated by fatty acid treatment, making it a valuable tool for studying changes in glycosylation patterns. Additionally, the TDG antibody has been shown to interact with epithelial cadherin, suggesting a potential role in cell adhesion and signaling pathways. With its high specificity and sensitivity, this monoclonal antibody is an essential tool for researchers studying glycan-related processes in human proteins.
XIAP antibody
The XIAP antibody is a monoclonal antibody that specifically targets the X-linked inhibitor of apoptosis protein (XIAP). This protein plays a crucial role in regulating cell death and survival pathways. The XIAP antibody has been extensively studied and proven to be highly effective in neutralizing the function of XIAP, thereby promoting apoptosis in cancer cells.
Tetracycline antibody
The Tetracycline antibody is a highly specific monoclonal antibody that binds to tetracycline, a broad-spectrum antibiotic. This antibody has a high receptor binding affinity and can be used in various applications, such as polymerase chain reactions (PCR), immunohistochemistry, and Western blotting. It specifically targets tetracycline residues in biological samples, allowing for the detection and quantification of this antibiotic. In addition to its use in research, the Tetracycline antibody has potential applications in the field of medicine. It can be used to study the cellular localization of tetracycline within cells or tissues, providing valuable insights into its mechanism of action. Furthermore, this antibody can be utilized to investigate protein-protein interactions involving tetracycline or its derivatives. The Tetracycline antibody is produced using advanced techniques in monoclonal antibody production. It exhibits high specificity and sensitivity, ensuring reliable and accurate results. This antibody is compatible with various sample types, including
Purity:≥90%
