Primary Antibodies

<p>Rabbit polyclonal QORX antibody</p>

<p>Purified Polyclonal ZIP9 antibody</p>

<p>Purified Polyclonal Fibulin 4 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug from the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its efficacy has been demonstrated through patch-clamp techniques on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, and conjugation. Additionally, it specifically binds to markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture.</p>

<p>The MCL1 antibody is a glycoprotein that plays a crucial role in cell survival and apoptosis regulation. It is involved in the binding of activated Bcl-2 family proteins, which control the intrinsic pathway of apoptosis. This antibody is commonly used in various assays and research studies to detect and quantify MCL1 expression levels.</p>

<p>The SURVIVIN antibody is a powerful tool in the field of Life Sciences. It is an essential biomolecule that plays a crucial role in cell survival and proliferation. This antibody specifically targets survivin, an anti-apoptotic protein that is highly expressed in various tumor cells.</p>

<p>TNF alpha antibody was raised in rabbit using highly pure recombinant rat TNF-alpha as the immunogen.</p>

<p>FAM98A antibody was raised using the middle region of FAM98A corresponding to a region with amino acids YTGSGYQGGGYQQDNRYQDGGHHGDRGGGRGGRGGRGGRGGRAGQGGGWG</p>

<p>ZNF783 antibody was raised in rabbit using the middle region of ZNF783 as the immunogen</p>

<p>The FKBPL antibody is a high-quality polyclonal antibody that is colloidal in nature. It specifically targets the thioredoxin interacting protein (FKBPL) and forms a strong disulfide bond with it. This antibody is widely used in life sciences research for various applications, including the study of reactive growth factors and biomolecules. It can also be used as a drug antibody or diagnostic reagent due to its high specificity and affinity for FKBPL. Additionally, this antibody has shown promising results in collagen-related research and can be used in electrode-based assays. For researchers looking for a reliable monoclonal antibody, the FKBPL antibody is an excellent choice. Its effectiveness against TGF-beta makes it an essential tool for studying this important signaling pathway.</p>

<p>Mouse monoclonal HBV Pres 1 antibody</p>

<p>The cSRC antibody is a highly specialized Polyclonal Antibody used in Life Sciences research. This antibody specifically targets the activated form of the cSRC protein, which plays a crucial role in cell signaling and regulation.</p>

<p>Rabbit anti-sheep IgG (HRP) was raised in rabbit using sheep IgG F(ab')2 fragment as the immunogen.</p>

<p>Purified Polyclonal CHERP antibody</p>

<p>The GATA1 antibody is a highly specialized product in the field of Life Sciences. It belongs to the class of monoclonal antibodies and is designed to target specific virus surface antigens. This antibody has been extensively tested and proven to effectively inhibit the growth and replication of viruses in human serum.</p>

<p>SIRT4 antibody was raised in rabbit using the N terminal of SIRT4 as the immunogen</p>

<p>The CD117 antibody is a monoclonal antibody that specifically targets the CD117 protein, also known as c-Kit. This protein is a receptor tyrosine kinase that plays a crucial role in the activation of endogenous hematopoietic stem cells. The CD117 antibody has been extensively studied and proven to be highly effective in neutralizing the activity of CD117.</p>

<p>Rabbit polyclonal TFDP1 antibody</p>

<p>FLJ25791 antibody was raised using the middle region of Flj25791 corresponding to a region with amino acids EYTRKKYKKKMEQFMESCELITYLGAKMTRKYKEPQFRAIDFDHKLKTFL</p>

<p>HHEX antibody was raised in mouse using recombinant Homeobox, Hematopoietically Expressed</p>

<p>Please enquire for more information about Cytomegalovirus (CMV) EIA Antigen including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>MMP9 antibody was raised in mouse using a synthetic peptide corresponding to amino acid 626-644 of human MMP9 as the immunogen.</p>

<p>EIF3C antibody was raised in Rabbit using Human EIF3C as the immunogen</p>

<p>Rabbit polyclonal PLANH1 antibody (biotin)</p>

<p>Purified Polyclonal TCP1 zeta antibody</p>

<p>Rabbit polyclonal TUBA1A antibody</p>