Primary Antibodies

HHIPL1 antibody was raised in rabbit using the C terminal of HHIPL1 as the immunogen

Rabbit polyclonal PP2A antibody (FITC)

The PSA antibody is a specific antibody that is reactive to protein carbonyls. It has been shown to be effective in ultrasensitive detection of PSA in human serum. The antibody can be used for various applications, including electrochemical impedance and carbon electrode assays. It is commonly used in Life Sciences research and is available as both monoclonal and polyclonal antibodies. The PSA antibody is highly reliable and provides accurate results for the detection of messenger RNA expression levels. It can be used in combination with aluminum hydroxide adjuvant for enhanced immune response. Trust the PSA antibody for your research needs in the field of Antibodies.

Rabbit polyclonal PFN4 antibody

The PAK1 antibody is a cytotoxic agent that targets the PAK1 isoenzyme. It belongs to the group of Polyclonal Antibodies, which are widely used in Life Sciences research. This antibody specifically binds to PAK1 and inhibits its activity, making it an essential tool for studying the role of PAK1 in various cellular processes. The PAK1 antibody can be used in experiments involving collagen, epidermal growth factor, hepatocyte growth factor, and other related molecules. It is available as a monoclonal antibody, ensuring high specificity and reproducibility in experiments. Additionally, this antibody has been shown to be activated in the presence of certain autoantibodies and levothyroxine, making it a versatile tool for multiple applications.

Rabbit polyclonal 14-3-3 alpha/beta antibody (FITC)

Mouse monoclonal PDE1B antibody

RPL39 antibody was raised in rabbit using the N terminal of RPL39 as the immunogen

FBXO24 antibody was raised using the middle region of FBXO24 corresponding to a region with amino acids QTLQDRTEKMKEIVGWMPLMAAQKDFFWEALDMLQRAEGGGGGVGPPAPE

CD69 antibody (biotin) was raised in hamster using Y245 murine dendritic epidermal T cell line as the immunogen.

PGK1 antibody was raised using the C terminal of PGK1 corresponding to a region with amino acids ATVASGIPAGWMGLDCGPESSKKYAEAVTRAKQIVWNGPVGVFEWEAFAR

Affinity purified Goat anti Human IgG antibody

The IL8 antibody is a highly specialized monoclonal antibody that plays a crucial role in the field of Life Sciences. It is specifically designed to target and bind to interleukin-8 (IL-8), a chemokine involved in inflammation and immune response. This antibody has shown great potential in various research applications, including immunohistochemistry, where it can be used to detect IL-8 expression in tissue samples.

CREM antibody was raised in Rabbit using Human CREM as the immunogen

Rabbit polyclonal S6K alpha 6 antibody

Eotaxin 3 antibody (biotin) was raised in goat using highly pure recombinant human eotaxin-3 as the immunogen.

CD11b antibody (Spectral Red) was raised in rat using C57BL/10 murine splenic T-cells and concanavalin A-activted C57BL/10 splenocytes as the immunogen.

The GPR132 antibody is a highly specialized chemokine that is activated in human serum. It is widely used in the field of Life Sciences and Antibodies for its ability to target specific growth factors, such as alpha-fetoprotein, and adipose tissues. This monoclonal antibody has a neutralizing effect on receptor binding, making it an effective tool for blocking specific pathways. The GPR132 antibody is commonly used in research settings, where it can be conjugated with colloidal phosphatase or other markers to facilitate detection. Its versatility and effectiveness make it an invaluable tool for studying various biological processes and identifying potential therapeutic targets.

SITPEC antibody was raised in rabbit using the middle region of SITPEC as the immunogen

The TEX14 antibody is a protein that acts as a growth factor, specifically targeting epidermal growth factor and hepatocyte growth inhibitory factor. It is an essential component in the field of Life Sciences and is widely used in research studies. The TEX14 antibody can be utilized as both a monoclonal and polyclonal antibody, making it versatile for various applications. Its high specificity allows for accurate detection and analysis of c-myc expression levels. Additionally, the TEX14 antibody has been found to be effective in detecting autoantibodies, making it valuable in diagnostic testing. With its robust capabilities, this antibody is an indispensable tool for researchers in the field.

Calibrator for Chicken ELISA Kit

The CD45RO antibody is a monoclonal antibody that specifically targets the CD45RO protein, which is expressed on activated T cells and memory T cells. This antibody has been extensively studied in the field of Life Sciences and has shown inhibitory effects on interleukin-6 (IL-6) signaling pathway and p38 MAPK activation. It has also been shown to inhibit syncytia formation, a process involved in viral infection.

The RASGRP4 antibody is a highly effective medicament that targets the circumsporozoite protein. This antibody specifically binds to the activated form of the protein, which is located in the nucleus. It has been shown to inhibit the activity of VEGF-C, human chorionic gonadotropin, and other antigens involved in angiogenesis. The RASGRP4 antibody can be used in immunohistochemistry studies to detect and visualize these proteins in various tissues. This product is a polyclonal antibody, meaning it is derived from multiple sources and provides a broad range of specificity. It is widely used in life sciences research to study endothelial growth factors and their role in various biological processes. With its high-quality performance and reliable results, this antibody is an essential tool for scientists and researchers working in the field of molecular biology.

Rabbit polyclonal NOC2 antibody

CD2 antibody (PE) was raised in rat using CD2/LFA-2 as the immunogen.

The HCG beta Antibody is a specific monoclonal antibody that is commonly used in Life Sciences research. It has been extensively studied and proven to be highly effective in various applications. This antibody specifically targets the influenza hemagglutinin, which plays a crucial role in receptor binding and viral entry.

The SCAP antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that can be used for immobilization on electrodes, making it ideal for various research applications. This antibody specifically targets and binds to SCAP (Sterol Regulatory Element-Binding Protein Cleavage-Activating Protein), which plays a crucial role in cholesterol metabolism and lipid homeostasis. By targeting SCAP, researchers can gain valuable insights into the regulation of these processes.

The A2M antibody is a powerful inhibitor of vascular endothelial growth factor (VEGF), which plays a crucial role in angiogenesis. It is also effective against other growth factors such as alpha-fetoprotein and erythropoietin. In addition, this antibody has been shown to inhibit the growth of Helicobacter, a bacteria that causes gastric ulcers. The A2M antibody works by binding to calmodulin, a protein involved in cell signaling, and preventing its activation. This inhibition leads to antiangiogenic effects and reduces the acidic environment necessary for tumor growth. Furthermore, the A2M antibody has anticoagulant properties that can be beneficial for patients with conditions such as heparin-induced thrombocytopenia. With its wide range of applications in life sciences, this polyclonal antibody is an essential tool for researchers and scientists working in various fields.

ABHD7 antibody was raised using the N terminal of ABHD7 corresponding to a region with amino acids HCYVRIKDSGLRFHYVAAGERGKPLMLLLHGFPEFWYSWRYQLREFKSEY

The Aggrecan antibody is a highly effective neutralizing agent used in the field of Life Sciences. This antibody is specifically designed to target and inhibit the activity of aggrecan, a growth factor that plays a crucial role in various biological processes. It has been extensively studied for its potential applications in mesenchymal stem cell research, as well as its ability to modulate TGF-beta signaling pathways.

Purified Rabbit polyclonal EPHA4 antibody (Tyr596)

The TPM2 antibody is a highly specialized protein kinase that plays a crucial role in various biological processes. It belongs to the family of polyclonal antibodies and is widely used in life sciences research. This antibody specifically targets β-catenin, a key protein involved in cell adhesion and signaling pathways. By binding to β-catenin, the TPM2 antibody can modulate its activity and regulate downstream cellular processes.

ABL2 antibody was raised in Mouse using a purified recombinant fragment of ABL2 expressed in E. coli as the immunogen.

CEA antibody was raised in mouse using human colon adrenocarcinoma as the immunogen.

Rabbit polyclonal IP6K3 antibody

Mouse monoclonal DYNC1LI1 antibody

UCHL5IP antibody was raised using the middle region of UCHL5IP corresponding to a region with amino acids LLDTIRSLTIGCSSCSSLMEHFEDTREKNEALLGELFSSPHLQMLLNPEC

SLC5A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids MASTVSPSTIAETPEPPPLSDHIRNAADISVIVIYFLVVMAVGLWAMLKT

The RARA antibody is a neutralizing monoclonal antibody that targets the endothelial growth factor. It has been shown to inhibit the growth and proliferation of cells involved in angiogenesis, making it a promising therapeutic option for various diseases related to abnormal blood vessel formation. This antibody specifically binds to fibronectin and collagen, forming a protein complex that disrupts the signaling pathways involved in angiogenesis. In addition, the RARA antibody has been found to have inhibitory effects on alpha-fetoprotein, a growth factor associated with certain types of cancer. Its potential applications in the field of life sciences make it an exciting area of research and development.

Rabbit polyclonal SERPINH1 antibody