Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
Ferritin heavy chain antibody
The Ferritin heavy chain antibody is a highly effective monoclonal antibody used in Life Sciences. It is designed to specifically target and bind to the Ferritin heavy chain protein, which plays a crucial role in iron storage and transport within cells. This antibody is colloidal in nature, making it easy to use in various experimental techniques.
TFE3 antibody
The TFE3 antibody is a monoclonal antibody that specifically targets CD33, an antigen expressed on the surface of certain cells. It belongs to the class of anti-CD33 antibodies and is widely used in life sciences research. The TFE3 antibody has been shown to bind to CD33 with high affinity, effectively blocking receptor binding and modulating downstream signaling pathways. This antibody can be used for various applications, including flow cytometry, immunohistochemistry, and western blotting. Additionally, the TFE3 antibody has been used in studies investigating autoimmune diseases, such as rheumatoid arthritis and systemic lupus erythematosus. Its ability to neutralize TNF-α and inhibit the activation of immune cells makes it a valuable tool in immunology research. Furthermore, this antibody has shown potential therapeutic effects in preclinical models of cancer by targeting CD33-expressing tumor cells. With its versatility and wide range of applications, the TFE3 antibody is an essential tool for
Goat anti Human IgM (HRP)
Goat anti-human IgM (HRP) was raised in goat using human IgM mu heavy chain as the immunogen.
Purity:Min. 95%RBM39 antibody
RBM39 antibody was raised using the N terminal of RBM39 corresponding to a region with amino acids ADDIDIEAMLEAPYKKDENKLSSANGHEERSKKRKKSKSRSRSHERKRSK
AKR1B10 antibody
AKR1B10 antibody was raised using a synthetic peptide corresponding to a region with amino acids NEHEVGEAIQEKIQEKAVKREDLFIVSKLWPTFFERPLVRKAFEKTLKDL
EGFL8 antibody
EGFL8 antibody was raised using the C terminal of EGFL8 corresponding to a region with amino acids QAGAWVRAVLPVPPEELQPEQVAELWGRGDRIESLSDQVLLLEERLGACS
FAM62B antibody
FAM62B antibody was raised using a synthetic peptide corresponding to a region with amino acids NSGPNSTIKMKIALRVLHLEKRERPPDHQHSAQVKRPSVSKEGRKTSIKS
Purity:Min. 95%NOTCH1 antibody
The NOTCH1 antibody is a monoclonal antibody that specifically targets the NOTCH1 protein. It is commonly used in various assays and research studies in the field of life sciences. This antibody has been extensively tested and validated for its specificity and sensitivity.
Plakophilin 2 antibody
Plakophilin 2 antibody was raised in Guinea Pig using human synthetic plakophilin 2 as the immunogen.Purity:Min. 95%RNF19A antibody
RNF19A antibody was raised using the N terminal of RNF19A corresponding to a region with amino acids IFSTNTSSDNGLTSISKQIGDFIECPLCLLRHSKDRFPDIMTCHHRSCVD
Purity:Min. 95%Fam55d antibody
Fam55d antibody was raised in rabbit using the C terminal of Fam55d as the immunogen
Purity:Min. 95%RPESP antibody
RPESP antibody was raised using the middle region of RPESP corresponding to a region with amino acids LRCSGDGLDSDGNQTLHWQAIGNPRCQGTWKKVRRVDQCSCPAVHSFIFI
Trazodone antibody
The Trazodone antibody is a reactive monoclonal antibody that falls under the category of Life Sciences. It is specifically designed to target and neutralize tumor necrosis factor-alpha (TNF-α) and interleukin (IL), which are key inflammatory factors in the body. This antibody has shown inhibitory effects on adipose tissue and chemokine production, making it a potential therapeutic option for conditions associated with inflammation and immune dysregulation. Additionally, the Trazodone antibody has been found to have neutralizing activity against Brucella abortus, a bacterium that causes brucellosis in animals and humans. This suggests its potential use in treating infections caused by this pathogen. Furthermore, this antibody exhibits inhibitory effects on family kinase inhibitors and calmodulin, which are involved in various cellular processes such as signal transduction and calcium signaling. By targeting these proteins, the Trazodone antibody may have implications for the treatment of diseases related to their dysPurity:Min. 95%RHOU antibody
RHOU antibody was raised using the C terminal of RHOU corresponding to a region with amino acids LKEVFDAAIVAGIQYSDTQQQPKKSKSRTPDKMKNLSKSWWKKYCCFV
Purity:Min. 95%Synaptotagmin antibody
The Synaptotagmin antibody is a highly specialized polyclonal antibody that is used in various assays and experiments in the field of Life Sciences. This antibody has the unique ability to neutralize the activity of glucose-6-phosphate, making it an essential tool for studying the role of this molecule in cellular processes. The Synaptotagmin antibody is available in both monoclonal and polyclonal forms, providing researchers with options to suit their specific needs. With its high affinity and specificity, this antibody can be used for a wide range of applications, including immunohistochemistry, Western blotting, and flow cytometry. Whether you are studying protein-protein interactions or investigating disease mechanisms, the Synaptotagmin antibody is an indispensable tool for your research. Trust in its reliability and accuracy to deliver accurate and reproducible results every time.
HES1 antibody
The HES1 antibody is a highly activated monoclonal antibody used in Life Sciences research. It specifically targets and binds to HES1, a protein involved in various cellular processes. This antibody has been shown to inhibit the activity of interferon-gamma (IFN-γ), glutamate, and interleukin-6 (IL-6) signaling pathways. Additionally, it can be used for the visualization of actin filaments in cells due to its high specificity towards actin. The HES1 antibody has a high viscosity, making it ideal for applications that require long-term stability and minimal sample loss. Furthermore, this antibody exhibits cytotoxic effects on targeted cells, making it a valuable tool for studies involving cell viability and apoptosis.
GSK3beta antibody
GSK3beta antibody was raised in mouse using recombinant human GSk3 beta (341-420aa) purified from E. coli as the immunogen.
GJC3 antibody
GJC3 antibody was raised in rabbit using the middle region of GJC3 as the immunogen
Purity:Min. 95%p73 antibody
The p73 antibody is a highly specialized polyclonal antibody used in the field of Life Sciences. It is designed to specifically target and bind to the p73 protein, which plays a crucial role in various cellular processes including cell growth, differentiation, and apoptosis. This antibody has been extensively tested and validated for its high specificity and sensitivity.
Purity:Min. 95%PDE7A antibody
PDE7A antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Purity:Min. 95%NPDC1 antibody
NPDC1 antibody was raised using the N terminal of NPDC1 corresponding to a region with amino acids MATPLPPPSPRHLRLLRLLLSGLVLGAALRGAAAGHPDVAACPGSLDCAL
QTRT1 antibody
QTRT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KDKPRYLMGVGYATDLVVCVALGCDMFDCVFPTRTARFGSALVPTGNLQL
DGKA antibody
The DGKA antibody is a highly specialized product in the field of Life Sciences. It is a colloidal inhibitory factor that targets cardiomyocytes. This antibody has been shown to have natriuretic effects when activated, making it a valuable tool for research in cardiovascular physiology. Additionally, the DGKA antibody has been found to possess autoantibodies against annexin A2, which further expands its potential applications. This product is available as a monoclonal antibody and can be used in various experimental setups. It can be conveniently detected using streptavidin-based detection systems and has neutralizing properties that make it suitable for functional studies. Researchers interested in glucagon-related pathways will find this DGKA antibody an indispensable tool for their investigations.
