Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
CACNB4 antibody
CACNB4 antibody was raised using the C terminal of CACNB4 corresponding to a region with amino acids LEAYWRATHTTSSTPMTPLLGRNLGSTALSPYPTAISGLQSQRMRHSNHS
CHST1 antibody
CHST1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SFVGQLFNQHLDVFYLFEPLYHVQNTLIPRFTQGKSPADRRVMLGASRDL
Donkey anti Sheep IgG (H + L) (FITC)
Donkey anti-sheep IgG (H + L) (FITC) was raised in donkey using sheep IgG (H&L) as the immunogen.
UCHL5IP antibody
UCHL5IP antibody was raised using the middle region of UCHL5IP corresponding to a region with amino acids LLDTIRSLTIGCSSCSSLMEHFEDTREKNEALLGELFSSPHLQMLLNPEC
SOCS3 antibody
The SOCS3 antibody is a monoclonal antibody used in Life Sciences research. It is specifically designed to neutralize the effects of tumor necrosis factor-alpha (TNF-α) and interferon-gamma (IFN-γ). This antibody is highly specific and has been extensively tested for its efficacy and reliability. The SOCS3 antibody can be used in various applications such as immunohistochemistry, Western blotting, and ELISA assays. It is supplied with all necessary excipients and can be easily conjugated to streptavidin or other molecules for specific hybridization. This antibody has shown promising results in inhibiting the growth factors associated with certain diseases, making it a valuable tool for researchers studying cytokine signaling pathways.Cat RBC antibody (FITC)
Feline RBC antibody (FITC) was raised in rabbit using feline erythrocytes as the immunogen.FYN antibody
The FYN antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and neutralize the activated form of the FYN protein, which plays a crucial role in various cellular processes. This antibody has been extensively tested and proven to effectively inhibit the activity of FYN, making it an invaluable tool for researchers studying signal transduction pathways and cellular signaling.
Arginase 2 antibody
Arginase 2 antibody was raised using the C terminal of ARG2 corresponding to a region with amino acids SALDLVEVNPQLATSEEEAKTTANLAVDVIASSFGQTREGGHIVYDQLPT
CKMM antibody
CKMM antibody was raised in mouse using CKMM purified from human smooth muscle as the immunogen.proBNP antibody
The proBNP antibody is a monoclonal antibody that specifically targets and inhibits the activity of proBNP, an important biomarker for heart failure. This antibody has been extensively studied and shown to effectively neutralize proBNP in human serum samples, making it a valuable tool in cardiovascular research and diagnostics. By blocking the binding of proBNP to its receptor, this antibody can help regulate the levels of this peptide hormone, which plays a crucial role in fluid balance and cardiac function. Additionally, the proBNP antibody has potential applications in therapeutic interventions for heart failure and other related conditions. Its specificity and high affinity make it an ideal candidate for further investigation in the field of cardiology and life sciences.
NUSAP1 antibody
NUSAP1 antibody was raised using the C terminal of NUSAP1 corresponding to a region with amino acids LKASLSRPLNYEPHKGKLKPWGQSKENNYLNQHVNRINFYKKTYKQPHLQ
PRKACB antibody
The PRKACB antibody is a highly specific antibody that targets the protein kinase A catalytic subunit beta (PRKACB). This antibody is derived from a vaccine strain and has been extensively tested for its antigen specificity. It has shown high affinity and selectivity for PRKACB, making it an ideal tool for studying the function and regulation of this protein.
AIFM3 antibody
AIFM3 antibody was raised using the middle region of AIFM3 corresponding to a region with amino acids EGFSDRIVLCTLDRHLPYDRPKLSKSLDTQPEQLALRPKEFFRAYGIEVL
P2RX2 antibody
P2RX2 antibody was raised using the N terminal of P2RX2 corresponding to a region with amino acids MAAAQPKYPAGATARRLARGCWSALWDYETPKVIVVRIHRAEKLPGERDG
LIPT1 antibody
LIPT1 antibody was raised using the N terminal of LIPT1 corresponding to a region with amino acids NCFQLLCNCQVPAAGFKKTVKNGLILQSISNDVYQNLAVEDWIHDHMNLE
WFDC1 antibody
WFDC1 antibody was raised using the middle region of WFDC1 corresponding to a region with amino acids VAEGIPNRGQCVKQRRQADGRILRHKLYKEYPEGDSKNVAEPGRGQQKHF
Streptococcus Group A antibody (FITC)
Streptococcus group A antibody (FITC) was raised in rabbit using group A Streptococci as the immunogen.ATP8B2 antibody
ATP8B2 antibody was raised using the N terminal of ATP8B2 corresponding to a region with amino acids MAVCAKKRPPEEERRARANDREYNEKFQYASNCIKTSKYNILTFLPVNLF
MED1 antibody
MED1 antibody is a protein that belongs to the category of polyclonal antibodies. It is commonly used in the field of life sciences for various applications. MED1 antibody specifically targets erythropoietin, adalimumab, and other autoantibodies. It can also be used to detect and measure levels of androgen, TGF-beta, alpha-fetoprotein, interferon, and other growth factors. This specific antibody provides researchers with a valuable tool for studying the role of these proteins in various biological processes and diseases. With its high specificity and sensitivity, MED1 antibody ensures accurate and reliable results in experiments and diagnostic assays.
MEF2C antibody
The MEF2C antibody is a cytotoxic monoclonal antibody that targets the MEF2C protein. It has been shown to have multidrug resistance and can inhibit the production of interleukin-6 and chemokines. This antibody specifically binds to the p38 mitogen-activated protein and glycoprotein receptors, leading to cell death in cancer cells. Additionally, it has been found to have an inhibitory effect on steroid and fibronectin synthesis, which are important for tumor growth and metastasis. The MEF2C antibody is widely used in life sciences research and shows promise as a potential therapeutic agent in cancer treatment, particularly in combination with other monoclonal antibodies like trastuzumab.Glycine Receptor alpha 2 antibody
Affinity purified Rabbit polyclonal Glycine Receptor alpha 2 antibody
