Primary Antibodies

CD45.1 antibody (Spectral Red) was raised in mouse using CD45.1 as the immunogen.

The ARAF antibody is a highly specialized monoclonal antibody that targets and neutralizes the ARAF protein. This protein plays a crucial role in cell growth and division, making it an important target for cancer therapy. The ARAF antibody binds to the ARAF protein, preventing its activation and inhibiting tumor growth.

PCNP antibody was raised using the middle region of PCNP corresponding to a region with amino acids AKMRMKNIGRDTPTSAGPNSFNKGKHGFSDNQKLWERNIKSHLGNVHDQD

The MAD2 antibody is a highly effective active agent that plays a crucial role in regulating cell division. It specifically targets messenger RNA (mRNA) and cell antigens, making it an essential tool in the field of Life Sciences. The MAD2 antibody is available in both polyclonal and monoclonal forms, providing researchers with versatile options for their experiments.

The FAK antibody is a highly specialized product in the field of Life Sciences. This monoclonal antibody plays a crucial role in various biological processes, including fatty acid metabolism, insulin signaling, and fibrinogen binding. It is designed to specifically target and bind to focal adhesion kinase (FAK), an important protein involved in cell adhesion and migration.

Mouse monoclonal NUDT6 antibody

The TS antibody is an autoantibody that specifically targets glial fibrillary acidic protein (GFAP), a protein found in the central nervous system. It is commonly used in life sciences research to study the role of GFAP in various cellular processes. The TS antibody recognizes specific epitopes on GFAP and can be used for immunohistochemistry, immunocytochemistry, and Western blotting applications. This monoclonal antibody has high specificity and sensitivity, making it a valuable tool for studying GFAP expression and function. Additionally, the TS antibody can be conjugated with different fluorophores or enzymes for multiplexing experiments or detection purposes. Whether you're researching neurodegenerative diseases or investigating cellular responses to growth factors, the TS antibody is an essential reagent for your experiments. Trust its reliability and performance to deliver accurate and reproducible results in your scientific endeavors.

ANTP antibody was raised using the C terminal Of Antp corresponding to a region with amino acids QQQQQPVVYASCKLQAAVGGLGMVPEGGSPPLVDQMSGHHMNAQMTLPHH

The IGFBP1 antibody is a powerful tool in the field of Life Sciences. This polyclonal antibody specifically targets and neutralizes insulin-like growth factor binding protein 1 (IGFBP1). IGFBP1 is a key regulator of neurotrophic factors, such as TGF-β1, and plays a crucial role in various biological processes. By blocking the activity of IGFBP1, this antibody can modulate important cellular functions including natriuretic signaling, collagen synthesis, chemokine production, protein kinase activation, and nuclear events. Whether you are conducting research or developing therapeutics, the IGFBP1 antibody is an invaluable asset that can help unravel the complex mechanisms underlying various diseases and pave the way for novel treatments.

Triosephosphate isomerase antibody is an antigen-specific antibody that specifically targets triosephosphate isomerase, a key enzyme involved in glycolysis. It is available as both polyclonal and monoclonal antibodies. These antibodies are widely used in life sciences research for various applications, including Western blotting, immunohistochemistry, and ELISA assays. Triosephosphate isomerase antibody can be used to study the expression and localization of triosephosphate isomerase in different tissues and cell types. It can also be used to investigate the role of triosephosphate isomerase in metabolic pathways and its potential as a therapeutic target. This antibody has been validated for its specificity and sensitivity, ensuring accurate and reliable results in experimental studies. Whether you are studying cellular processes, protein-protein interactions, or disease mechanisms, triosephosphate isomerase antibody will be a valuable tool in your research endeavors.

The Midkine antibody is a powerful tool in Life Sciences research. Midkine is a growth factor that plays a crucial role in various biological processes, including cell proliferation, migration, and survival. It interacts with TGF-β1 and other binding proteins to regulate the activity of the erythropoietin receptor.

Rabbit polyclonal FOXD4L1 antibody

Sheep polyclonal Hydroxyindole antibody

CD19 antibody (Spectral Red) was raised in mouse using CD19+ murine pre-B cell line as the immunogen.

The IFN gamma antibody is a monoclonal antibody that targets interferon gamma, a cytokine involved in immune response regulation. This antibody specifically binds to interferon gamma and neutralizes its activity, making it an effective tool for research in the field of immunology. The IFN gamma antibody has been widely used in various life science applications, including ELISA, Western blotting, flow cytometry, and immunohistochemistry. It can be conjugated with different labels such as biotin or fluorescent dyes for detection purposes. Researchers rely on this antibody to study the role of interferon gamma in various diseases and to develop potential therapeutic strategies targeting this cytokine.

ASNS antibody was raised in Rabbit using Human ASNS as the immunogen

The TBLR1 antibody is a highly specialized product that plays a crucial role in the field of Life Sciences. It acts as a growth factor and has been extensively studied for its potential therapeutic applications. This antibody specifically targets caspase-9, an enzyme involved in programmed cell death.

Rabbit polyclonal Casein kinase 2 antibody (HRP)

Rabbit polyclonal THOC6 antibody

Chromogranin A antibody was raised in mouse using human pheochromocytoma as the immunogen.

Caspase 8 antibody is a highly specific monoclonal antibody that targets caspase 8, an enzyme involved in programmed cell death. This antibody has been extensively tested and validated for its ability to detect and inhibit caspase 8 activity. It can be used in various life science research applications including immunohistochemistry, western blotting, and flow cytometry. The Caspase 8 antibody has been shown to effectively block the activity of caspase 8, making it a valuable tool for studying apoptosis and cell death pathways. Its high specificity ensures accurate and reliable results, making it an essential component in many research projects.

HRP conjugated Rabbit polyclonal Ovalbumin antibody

Kallikrein antibody is a powerful tool used in life sciences research. It targets kallikrein, an enzyme involved in various physiological processes such as blood pressure regulation, inflammation, and tissue remodeling. This antibody can inhibit the activity of kallikrein by binding to its active site, thus preventing its interaction with substrates.

The SIX1 antibody is a polyclonal antibody that specifically targets the SIX1 protein. This antibody is commonly used in research and diagnostic applications to detect the presence of SIX1 in various samples. It can be used in techniques such as immunohistochemistry, Western blotting, and ELISA.

Affinity purified Rabbit polyclonal Proteasome 20S alpha 6 antibody

GBP1 antibody was raised in Rabbit using Human GBP1 as the immunogen

Goat anti-human IgG (Alk Phos) was raised in goat using human IgG F(c) fragment as the immunogen.

Rabbit polyclonal PYGB antibody

The GAD65 antibody is a multidrug growth factor that plays a crucial role in various biological processes. It is a monoclonal antibody that specifically targets and binds to GAD65, an enzyme involved in the production of insulin and glucagon. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in research related to diabetes and autoimmune disorders.

Affinity purified Rabbit polyclonal GIPC3 antibody

The Sumo1 antibody is a polyclonal antibody that is used for the immobilization of human serum on an electrode. It is commonly used in research and laboratory settings to study the binding proteins and inhibitors involved in various cellular processes. This antibody has also been shown to have neutralizing effects on interferon, making it a valuable tool in immunology research. Additionally, the Sumo1 antibody has demonstrated neuroprotective properties and has been investigated for its potential use in treating neurodegenerative disorders. However, it is important to note that this antibody may have teratogenic effects and should be handled with caution. In the field of Life Sciences, the Sumo1 antibody plays a crucial role in understanding cellular pathways and protein interactions.

Affinity purified Rabbit polyclonal PEX19 antibody

Affinity purified Rabbit polyclonal ADAMTSL2 antibody

This antibody reacts with heavy (gamma) chains on mouse IgG.

Mouse monoclonal gp130 antibody (biotin)

Rabbit polyclonal CYP24A1 antibody

HSD3B7 antibody was raised in Rabbit using Human HSD3B7 as the immunogen

Armenian Hamster monoclonal CD49e antibody (FITC)

The COL1A2 antibody is a powerful tool in Life Sciences research. This antibody has inhibitory properties and can be used in various applications such as insulin immunoassays and the study of liver microsomes. It belongs to the class of Polyclonal Antibodies, which are highly specific and versatile. The COL1A2 antibody can be used to detect and quantify interferon, TGF-β1, and other autoantibodies in samples. It specifically targets nuclear tyrosine residues that are activated during cellular processes. Researchers rely on this monoclonal antibody for its exceptional sensitivity and reliability in their experiments.

FICD antibody was raised using the C terminal Of Ficd corresponding to a region with amino acids FAALAHYKLVYIHPFIDGNGRTSRLLMNLILMQAGYPPITIRKEQRSDYY

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.