Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
Complement C4 antibody
Complement C4 antibody was raised in goat using highly purified human complement protein as the immunogen.Purity:Min. 95%GLP1 antibody
The GLP1 antibody is a monoclonal antibody that acts as an immunosuppressant. It targets specific molecules such as alpha-fetoprotein, calmodulin, and angptl3, inhibiting their activity. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in neutralizing the effects of these molecules. Additionally, it has been found to have an inhibitory effect on phosphatase activity. The GLP1 antibody can be used in various applications, including research studies and therapeutic interventions. Its unique properties make it a valuable tool for investigating adipose tissue biology, colloidal chemistry, chemokine signaling pathways, and human serum analysis. With its high specificity and efficacy, this antibody is an essential component for any laboratory or research facility looking to advance their understanding of these biological processes.Methcathinone Antibody
The Methcathinone Antibody is a highly specialized antibody that exhibits insulin-like properties and interferes with the function of specific antigens. This monoclonal antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications. It has been found to effectively bind to recombinant proteins, growth factors, interleukins, and IFN-gamma, inhibiting their activity and preventing their interaction with target receptors. Additionally, this antibody has been immobilized on activated fatty acids, allowing for easy purification and isolation of target molecules. With its unique tyrosine-based structure, the Methcathinone Antibody offers a valuable tool for researchers in need of a reliable and efficient method for studying sumoylation processes and investigating the role of specific antigens in cellular functions.
STX10 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, which ultimately inhibits bacterial growth. Its efficacy has been demonstrated through various scientific techniques such as transcription-quantitative polymerase chain and patch-clamp technique. The drug undergoes several metabolic transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Furthermore, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside exhibits high affinity for markers expressed in Mycobacterium tuberculosis strains and effectively inhibits their growth in culture.
SLC22A16 antibody
SLC22A16 antibody was raised using a synthetic peptide corresponding to a region with amino acids CSRNKRENTSSLGYEYTGSKKEFPCVDGYIYDQNTWKSTAVTQWNLVCDR
HDAC3 antibody
The HDAC3 antibody is a highly specialized antibody that targets the hydroxyl groups on specific proteins. It is designed to neutralize the reactive properties of these proteins, particularly c-myc. This antibody has been extensively studied in the field of Life Sciences and is widely recognized for its efficacy. It is available in both polyclonal and monoclonal forms, allowing researchers to choose the most suitable option for their experiments. The HDAC3 antibody has also shown promising results as a protein-coupled therapeutic agent, with potential applications in cytotoxicity and inhibition of bace1 activity. Additionally, it has been found to reduce the production of reactive oxygen species, making it a valuable tool in oxidative stress research. Whether you are conducting basic research or developing new therapies, the HDAC3 antibody is an essential component of your toolkit.
IFNAR1 antibody
The IFNAR1 antibody is a highly specific monoclonal antibody used in Life Sciences research. It is designed to target and bind to the IFNAR1 protein, which plays a crucial role in the immune response. This antibody has been extensively tested and validated for its efficacy in various applications, including Western blotting, immunoprecipitation, and immunofluorescence.
CD19 antibody (Allophycocyanin)
CD19 antibody (Allophycocyanin) was raised in rat using murine CD19-expressing K562 human erythroleukemia cells as the immunogen.
Purity:Min. 95%Serotonin Transporter antibody
Serotonin transporter antibody was raised in mouse using at serotonin transporter, N-terminus/GST Fusion protein (amino acids 1-85) as the immunogen.
Antithrombin III antibody
Antithrombin III antibody was raised in goat using human antithrombin purified from plasma as the immunogen.Purity:Min. 95%Ubiquilin 3 antibody
Ubiquilin 3 antibody was raised using the N terminal of UBQLN3 corresponding to a region with amino acids LMRQHVSVPEFVTQLIDDPFIPGLLSNTGLVRQLVLDNPHMQQLIQHNPE
CKMM antibody
CKMM antibody was raised using the N terminal of CKM corresponding to a region with amino acids VGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDL
Goat anti Rat IgG (H + L) (FITC)
This antibody reacts with heavy (gamma) chains on rat IgG and light chains on all rat immunoglobulins.
Purity:Min. 95%ADAM10 antibody
The ADAM10 antibody is a highly specialized cytotoxic antibody that targets the tyrosine protease ADAM10. It is widely used in Life Sciences research, particularly in immunohistochemistry studies. This polyclonal antibody has been shown to inhibit the activity of ADAM10, which plays a crucial role in various cellular processes such as interleukin-6 and insulin signaling. The ADAM10 antibody is commonly used as a tool to study the function of this protein and its involvement in disease pathways. Researchers also use monoclonal antibodies against ADAM10 for specific applications, such as insulin or interleukin detection. Additionally, this antibody has potential therapeutic applications due to its ability to modulate ADAM10 activity and downstream effects on cellular processes. Its specificity and high affinity make it an essential tool for studying the biology of ADAM10 and its associated pathways.
ADAM17 antibody
The ADAM17 antibody is a monoclonal antibody that specifically targets ADAM17, also known as tumor necrosis factor-alpha converting enzyme (TACE). This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications.
Goat anti Rabbit IgG (H + L) (FITC)
Goat anti-rabbit IgG (H + L) (FITC) was raised in goat using rabbit IgG, (H&L) as the immunogen.
TFPI antibody
TFPI antibody is a monoclonal antibody that targets tissue factor pathway inhibitor (TFPI), a protein involved in the regulation of blood clotting. TFPI antibody inhibits the activity of TFPI, which leads to increased blood clotting and reduced bleeding. This antibody has been shown to have anti-VEGF (vascular endothelial growth factor) properties, which may be beneficial in the treatment of diseases involving abnormal blood vessel growth, such as cancer and age-related macular degeneration. Additionally, TFPI antibody has been found to modulate hormone levels, including adipose and epidermal growth factors, which play important roles in various physiological processes. The use of TFPI antibody in Life Sciences research has also demonstrated its potential as a tool for studying the mechanisms of blood clotting and angiogenesis.
FZD4 antibody
The FZD4 antibody is a highly specialized antibody that targets the FZD4 protein. This protein plays a crucial role in various cellular processes, including actin dynamics and signaling pathways involved in development and disease. The FZD4 antibody is available in both polyclonal and monoclonal forms, offering researchers the flexibility to choose the best option for their specific experiments.
WBSCR1 antibody
WBSCR1 antibody was raised using the middle region of Wbscr1 corresponding to a region with amino acids DSRDDFNSGFRDDFLGGRGGSRPGDRRTGPPMGSRFRDGPPLRGSNMDFR
ApoJ antibody
ApoJ antibody was raised in goat using human apolipoprotein type J as the immunogen.Purity:Min. 95%Influenza Virus Ns1A Binding Protein antibody
Influenza Virus Ns1A Binding Protein antibody was raised using the N terminal of IVNS1ABP corresponding to a region with amino acids RAVLACCSPYLFEIFNSDSDPHGISHVKFDDLNPEAVEVLLNYAYTAQLK
CD24 antibody (PE)
CD24 antibody (PE) was raised in rat using murine heat stable antigen as the immunogen.
Purity:Min. 95%HBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productCA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
