Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
MIP4 antibody
MIP4 antibody was raised in rabbit using highly pure recombinant hMIP-4 as the immunogen.
SLC22A18 antibody
SLC22A18 antibody was raised using the middle region of SLC22A18 corresponding to a region with amino acids IQCPAILAALATLLGAVLSFTCIPASTKGAKTDAQAPLPGGPRASVFDLK
Purity:Min. 95%PFK antibody
The PFK antibody is a highly specialized polymerase enzyme that acts as a neutralizing agent. It is a monoclonal antibody specifically designed to target collagen and inhibit its activity. This antibody has shown great potential in the field of Life Sciences, particularly in research related to TGF-beta1, albumin, phosphatase, growth factors, interferon, glutamate, and dopamine. Its unique mechanism of action makes it an invaluable tool for studying various biological processes and pathways. Whether you're conducting experiments or exploring new therapeutic avenues, the PFK antibody is sure to be an asset in your scientific endeavors.
RALGPS2 antibody
RALGPS2 antibody was raised using the C terminal of RALGPS2 corresponding to a region with amino acids YLGIYLSDLTYIDSAYPSTGSILENEQRSNLMNNILRIISDLQQSCEYDI
Goat anti Human IgG (H + L) (HRP)
Goat anti Human IgG (H + L) secondary antibody (HRP)Purity:Min. 95%CD272 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to treat tuberculosis infections by targeting active compounds and exhibiting bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication in bacteria. Extensive research has shown its effectiveness through the patch-clamp technique on human erythrocytes. Metabolically, it undergoes hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds to specific markers expressed in Mycobacterium tuberculosis strains and effectively inhibits their growth in culture.
Osteopontin antibody
The Osteopontin antibody is a highly effective monoclonal antibody that targets the protein osteopontin. It is specifically designed to bind to this protein and inhibit its activity. Osteopontin is involved in various biological processes, including cell adhesion, migration, and inflammation. By targeting osteopontin, this antibody can potentially have therapeutic applications in various diseases, including cancer and autoimmune disorders.Rabbit anti Goat IgG (H + L) (FITC)
Rabbit anti-goat IgG (H+L) (FITC) was raised in rabbit using goat IgG whole molecule as the immunogen.Purity:Min. 95%APCS antibody
APCS antibody was raised using the N terminal of APCS corresponding to a region with amino acids NFTLCFRAYSDLSRAYSLFSYNTQGRDNELLVYKERVGEYSLYIGRHKVT
GLUT4 antibody
The GLUT4 antibody is a polyclonal antibody used in the life sciences field. It specifically targets binding proteins involved in the regulation of glucose transport. This antibody has been extensively tested and validated for its specificity and sensitivity. It has been shown to effectively detect GLUT4 expression in various tissues and cell types.
FSH antibody
The FSH antibody is a highly specialized immunohistochemistry tool used in the field of Life Sciences. It specifically targets the tumor necrosis factor-alpha (TNF-α) and acts as a kinase receptor growth factor. This polyclonal antibody plays a crucial role in binding proteins and cytotoxicity, particularly against tyrosine kinase receptors.
Purity:Min. 95%NPDC1 antibody
NPDC1 antibody was raised using the N terminal of NPDC1 corresponding to a region with amino acids MATPLPPPSPRHLRLLRLLLSGLVLGAALRGAAAGHPDVAACPGSLDCAL
IFITM1 antibody
The IFITM1 antibody is a chemokine that plays a crucial role in immune response modulation. It is a polyclonal antibody that specifically targets the proprotein encoded by the IFITM1 gene. This antibody can be used for various applications in life sciences, including research and diagnostic purposes.
ATG5 antibody
ATG5 antibody was raised using a synthetic peptide corresponding to a region with amino acids DPEDGEKKNQVMIHGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTDPurity:Min. 95%GAD65 antibody
GAD65 antibody is a polyclonal antibody that is commonly used in Life Sciences research. This antibody specifically targets the enzyme glutamate decarboxylase 65 (GAD65). GAD65 plays a crucial role in the synthesis of gamma-aminobutyric acid (GABA), an inhibitory neurotransmitter in the central nervous system. The cytotoxic effects of GAD65 antibodies have been studied in various research models, including androgen-treated prostate cancer cells, where it was found to inhibit cell proliferation and induce apoptosis.
QTRT1 antibody
QTRT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KDKPRYLMGVGYATDLVVCVALGCDMFDCVFPTRTARFGSALVPTGNLQL
Goat anti Human IgG + IgA + IgM (Alk Phos)
This antibody reacts with heavy chains on human IgA + IgG + IgM and light chains on all human immunoglobulins.
Purity:Min. 95%CD8a antibody
CD8a antibody was raised in Mouse using the alpha chainc of chicken CD8 as the immunogen.
Procainamide antibody
Procainamide antibody was raised in mouse using procainamide conjugated to KLH as the immunogen.Lactoferrin antibody
Lactoferrin antibody was raised in Mouse using Human lactoferrin as the immunogen.APP antibody
The APP antibody is a powerful tool used in medical research and diagnostics. It specifically targets alpha-fetoprotein (AFP), which is an important biomarker for various diseases, including liver cancer. The APP antibody binds to amyloid plaques, which are abnormal protein deposits found in the brains of individuals with Alzheimer's disease. This antibody can also be used to study growth factors and their binding proteins, providing valuable insights into cellular processes and signaling pathways.
Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productHBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%CA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
