Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75448 products of "Primary Antibodies"
SLC25A29 antibody
SLC25A29 antibody was raised using the C terminal of SLC25A29 corresponding to a region with amino acids AEGWRVFTRGLASTLLRAFPVNAATFATVTVVLTYARGEEAGPEGEAVPA
OMG antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is known to effectively treat tuberculosis infections by targeting active compounds and exhibiting bactericidal activity. Through its binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth, preventing transcription and replication. Its efficacy has been demonstrated through patch-clamp technique studies on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, and conjugation with glucuronic acid. Additionally, it specifically binds to markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture.
iNOS antibody
The iNOS antibody is a neuroprotective monoclonal antibody that targets inducible nitric oxide synthase (iNOS). It is commonly used in Life Sciences research and has shown promising results in various studies. This antibody specifically binds to iNOS, inhibiting its activity and preventing the production of nitric oxide. Nitric oxide is a signaling molecule that plays a role in various physiological processes, including inflammation and neuronal signaling. By blocking iNOS, the antibody can help reduce inflammation and protect neurons from damage.
WFDC1 antibody
WFDC1 antibody was raised using the middle region of WFDC1 corresponding to a region with amino acids VAEGIPNRGQCVKQRRQADGRILRHKLYKEYPEGDSKNVAEPGRGQQKHF
Fibrinogen antibody
Fibrinogen antibody was raised in sheep using human Fibrinogen purified from plasma as the immunogen.
ESE1 antibody
Human ESE1 internal region immunogen; affinity purified Rabbit polyclonal ESE1 antibody
HBsAg antibody (FITC)
HBsAg antibody (FITC) was raised in goat using subtypes ad & ay as the immunogen.Protein C antibody
Protein C antibody is a highly specialized antibody that targets the activated form of protein C, an important regulator of blood coagulation. This antibody specifically recognizes the active form of protein C and can be used in various research applications, particularly in the field of life sciences.
Rel antibody
Rel antibody is a highly specialized product used in Life Sciences research. It is a polyclonal antibody that specifically targets and neutralizes the epidermal growth factor (EGF). This antibody is produced using state-of-the-art technology and contains high-quality excipients to ensure stability and efficacy. Rel antibody has been extensively tested and validated for use in various applications, including ELISA assays, Western blotting, immunohistochemistry, and more. It is highly specific and exhibits strong binding affinity towards EGF, making it a valuable tool for studying EGF-related signaling pathways. Whether you're investigating the role of EGF in cancer development or exploring its effects on insulin signaling, Rel antibody is an essential component of your research toolkit. Trust in its reliability and accuracy to enhance your scientific discoveries.
Factor VIII antibody
Factor VIII antibody was raised in mouse using human factor VIII as the immunogen.
p16 antibody
P16 antibody was raised in Mouse using a purified recombinant fragment of P16 expressed in E. coli as the immunogen.FBXL20 antibody
FBXL20 antibody was raised in rabbit using the middle region of FBXL20 as the immunogen
IKK alpha/beta antibody (Phospho-Ser176)
Rabbit polyclonal IKK alpha/beta antibody for detection of the Phospho-Ser176 form of the IKK alpha/beta peptide.
HSV1 antibody (FITC)
HSV1 antibody (FITC) was raised in goat using HSV type 1, strain F as the immunogen.BTK antibody
BTK antibody was raised in Mouse using a purified recombinant fragment of BTK expressed in E. coli as the immunogen.
TM9SF1 antibody
TM9SF1 antibody was raised using the N terminal of TM9SF1 corresponding to a region with amino acids EGVTHYKAGDPVILYVNKVGPYHNPQETYHYYQLPVCCPEKIRHKSLSLG
AVEN antibody
The AVEN antibody is a highly specialized monoclonal antibody that targets specific molecules in the body. It is particularly effective in binding to β-catenin, collagen, anti-mesothelin, and urokinase plasminogen activator. This antibody is widely used in Life Sciences research for its ability to detect and inhibit the activity of these target molecules.
MFAP3L antibody
MFAP3L antibody was raised using the N terminal of MFAP3L corresponding to a region with amino acids MHDSGLLNITKVSFSDRGKYTCVASNIYGTVNNTVTLRVIFTSGDMGVYY
BIM antibody
The BIM antibody is a highly specialized product in the field of Life Sciences. It falls under the category of Antibodies and is known for its cytotoxic properties. This colloidal antibody specifically targets epidermal growth factor (EGF) and acts as a neutralizing agent against it. It is also effective against other growth factors such as TGF-beta. The BIM antibody comes in both polyclonal and monoclonal forms, providing options for different research needs. In addition to its role in inhibiting the activity of EGF-like molecules, this antibody has shown potential in targeting chemokines and endothelial growth factors. The BIM antibody is carefully formulated with buffer solutions to ensure stability and optimal performance. It can be used in various research applications within the Life Sciences field, making it an essential tool for scientists and researchers alike.
PGCP antibody
The PGCP antibody is a synthetic polyclonal antibody that specifically targets glutamate. It can be used in Life Sciences research for various applications, including staining and detection of glutamate in cells and tissues. The antibody solution contains streptavidin-conjugated alkaline phosphatase, which allows for chromogenic or fluorescent detection methods. The PGCP antibody has high affinity and specificity towards glutamate, making it a valuable tool for studying the role of this neurotransmitter in biological processes. Its conjugation to alkaline phosphatase enables easy visualization and quantification of glutamate levels in samples using chromogenic or fluorescent molecules.
IL17A antibody
IL17A antibody is a monoclonal antibody that specifically targets and inhibits the activity of IL-17A, a cytokine involved in immune responses and inflammation. IL-17A plays a crucial role in various autoimmune diseases and inflammatory conditions. The IL17A antibody binds to IL-17A receptors, preventing the interaction between IL-17A and its receptors. This inhibition leads to a reduction in the production of pro-inflammatory molecules and cytokines, thereby suppressing the immune response. The IL17A antibody is widely used in immunoassays to detect and quantify IL-17A levels in biological samples. It is also utilized in research studies to investigate the role of IL-17A in different diseases and as a potential therapeutic target for treating inflammatory disorders. With its high specificity and potency, the IL17A antibody provides researchers with valuable tools for understanding the complex mechanisms underlying immune system dysregulation.
HLA-DQA2 antibody
HLA-DQA2 antibody was raised using the N terminal of HLA-DQA2 corresponding to a region with amino acids GVNFYQSHGPSGQYTHEFDGDEEFYVDLETKETVWQLPMFSKFISFDPQS
PTGES3 antibody
The PTGES3 antibody is a highly specialized product used in the field of Life Sciences. It is an isolated nucleic acid that specifically targets the PTGES3 gene, which encodes for the enzyme prostaglandin E synthase 3. This enzyme plays a crucial role in the synthesis of prostaglandins, which are important signaling molecules involved in various physiological processes such as inflammation and pain.
Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productDengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%HBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%CA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
