Primary Antibodies

Affinity purified Rabbit polyclonal Copine 3 antibody

Affinity purified Rabbit polyclonal SNTB2 antibody

Affinity purified Rabbit polyclonal ST3GAL2 antibody

The Connexin 43 antibody is a highly specialized antibody used in Life Sciences research. It targets the protein Connexin 43, which plays a crucial role in cell communication and signaling. This antibody is available in both polyclonal and monoclonal forms.

ATP1B1 antibody was raised in Rabbit using Human ATP1B1 as the immunogen

The HSF2 antibody is a polyclonal antibody that is derived from human serum. It is used in various applications such as electrode coating, immunohistochemistry, and western blotting. This antibody specifically targets histidine-rich proteins and autoantibodies present in the sample. The HSF2 antibody can be used in combination with other antibodies, such as monoclonal antibodies, to enhance its specificity and sensitivity. It is commonly used in life sciences research to study the role of histidine-rich proteins in various biological processes, including dopamine and insulin signaling, growth factor signaling (such as epidermal growth factor), and neutralizing effects on specific antigens. The HSF2 antibody is formulated with excipients to ensure stability and long shelf life.

The TNFSF9 antibody is a highly specialized product used in the field of Life Sciences. This monoclonal antibody is designed to target and neutralize TNFSF9, a growth factor involved in various biological processes. The antibody has been extensively modified to enhance its efficacy and specificity, including acid modifications and glycosylation.

GADD45GIP1 antibody was raised in Rabbit using Human GADD45GIP1 as the immunogen

The NLK antibody is a powerful tool in the field of Life Sciences. This polyclonal antibody has neutralizing properties and is able to bind to various growth factors, including fibrinogen, collagen, and fibronectin. It has been extensively tested in human serum and has shown high affinity for alpha-fetoprotein and anti-mesothelin antibodies. The NLK antibody can be used in a variety of applications, such as immunohistochemistry, Western blotting, and ELISA assays. With its exceptional binding capacity and specificity, this antibody is an invaluable resource for researchers in the field. Whether you're studying cell signaling pathways or investigating protein-protein interactions, the NLK antibody will provide reliable results and contribute to the advancement of scientific knowledge.

TNFRSF18 antibody was raised in rabbit using the C terminal of TNFRSF18 as the immunogen

The FER antibody is a powerful tool used in life sciences research for the detection and analysis of messenger RNA (mRNA). It belongs to the category of antibodies, specifically polyclonal antibodies. This cytotoxic antibody is designed to target specific proteins, particularly glycoproteins, and can be used for various applications such as protein immobilization and chromatographic purification. The FER antibody has the unique ability to neutralize binding proteins, including growth factors like hepatocyte growth factor and angiopoietin-like 3 (ANGPTL3). Its high specificity and sensitivity make it an invaluable asset in the field of molecular biology and biomedical research.

Affinity purified Goat polyclonal Presenilin 2 antibody

The RPA70 antibody is a highly specific reagent used in scientific research for various applications. It is commonly used in polymerase chain reactions (PCR) and immunohistochemical detection to study protein-protein interactions and cellular processes. This polyclonal antibody recognizes the RPA70 protein, which plays a crucial role in DNA replication and repair.

Affinity purified Rabbit polyclonal GIMAP8 antibody

The RALB antibody is a powerful tool in the field of Life Sciences. It is a polyclonal antibody that specifically targets the RALB protein, which plays a crucial role in various cellular processes such as epidermal growth factor signaling, low-molecular-weight chemokine production, and endothelial cell growth. This antibody has been extensively used in research to study the function and regulation of RALB.

Affinity purified Rabbit polyclonal Glucocorticoid Receptor beta antibody

The IDO antibody is a highly specialized product used in Life Sciences research. It is a monoclonal antibody that specifically targets the enzyme indoleamine 2,3-dioxygenase (IDO). This enzyme plays a crucial role in the regulation of immune responses and is involved in various physiological processes. The IDO antibody has been extensively used to study the function and activity of IDO in different cell types and tissues.

The CNPase antibody is a highly specialized monoclonal antibody that is used in various research and diagnostic applications. It is specifically designed to target and bind to CNPase, an enzyme that plays a crucial role in the central nervous system. This antibody has been extensively tested and validated for its specificity and sensitivity in detecting CNPase in human serum samples.

Affinity purified Rabbit polyclonal C5L2 antibody

RGS16 antibody was raised using the C terminal of RGS16 corresponding to a region with amino acids DAAQGKTRTLMEKDSYPRFLKSPAYRDLAAQASAASATLSSCSLDEPSHT

The MPP1 antibody is a powerful tool in the field of life sciences. It belongs to the class of antibodies and specifically targets interleukin, an important cytokine involved in various immune responses. This antibody can be used in assays and experiments to detect and measure the levels of interleukin in samples. It is also useful for studying autoantibodies, which are antibodies that target the body's own tissues.

The CDK2 antibody is a powerful tool used in Life Sciences research. It specifically targets and binds to cyclin-dependent kinase 2 (CDK2), a protein that plays a crucial role in cell cycle regulation. By binding to CDK2, this antibody can inhibit its activity and prevent cell division.

Armenian Hamster monoclonal CD49e antibody (FITC)

Affinity purified Rabbit polyclonal ADAMTSL2 antibody

Affinity purified Rabbit polyclonal PEX19 antibody

The GAD65 antibody is a multidrug growth factor that plays a crucial role in various biological processes. It is a monoclonal antibody that specifically targets and binds to GAD65, an enzyme involved in the production of insulin and glucagon. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in research related to diabetes and autoimmune disorders.

The ARAF antibody is a highly specialized monoclonal antibody that targets and neutralizes the ARAF protein. This protein plays a crucial role in cell growth and division, making it an important target for cancer therapy. The ARAF antibody binds to the ARAF protein, preventing its activation and inhibiting tumor growth.

Rabbit polyclonal ALAS1 antibody raised against the N terminal of ALAS1

Affinity purified Rabbit polyclonal G-Catenin antibody

Rabbit polyclonal CaMK2 alpha/beta/theta antibody

Affinity purified Rabbit polyclonal PMM2 antibody

Insulin antibody is a specialized antibody that is used for the detection and measurement of insulin levels in various biological samples. It can be used in research, diagnostic, and clinical settings to study conditions such as hyperinsulinaemic hypoglycaemia or insulin resistance. This antibody is produced by antibody-secreting cells and can be obtained in both polyclonal and monoclonal forms. The polyclonal antibodies are derived from animals immunized with recombinant human insulin, while the monoclonal antibodies are generated through hybridoma technology. Insulin antibodies specifically bind to insulin molecules present in the sample, allowing for their detection and quantification. This enables researchers and healthcare professionals to accurately measure insulin levels in human serum or other biological fluids. The use of insulin antibodies offers a reliable and sensitive method for insulin detection. These antibodies have been extensively validated for their specificity and sensitivity, ensuring accurate results. They recognize specific epitopes on the insulin molecule, such as certain amino acid residues or the

FBXL14 antibody was raised in Rabbit using Human FBXL14 as the immunogen

MMP1 antibody was raised in mouse using a synthetic peptide (VQGQNVLHGYPKDIYSSFG) corresponding to amino acid residues 332-350 0f human MMP-1 as the immunogen.

Rabbit polyclonal NDF2 antibody

Affinity purified Rabbit polyclonal PDIR antibody

CTTN antibody was raised in Rabbit using Human CTTN as the immunogen

WDR3 antibody was raised in rabbit using the middle region of WDR3 as the immunogen

The ZC3H12A antibody is a polyclonal antibody that is used in life sciences research. It has been shown to interact with various proteins and molecules, including alpha-fetoprotein, macrophage colony-stimulating factor, interferon, phosphatase, acidic glutamate, and vasoactive intestinal peptide. This antibody is commonly used in studies related to immune response and cell signaling pathways. It specifically targets the ZC3H12A protein, which is known to play a role in regulating inflammatory responses. The ZC3H12A antibody can be used for various applications such as immunohistochemistry, western blotting, and enzyme-linked immunosorbent assays (ELISA). Its high specificity and sensitivity make it a valuable tool for researchers studying immune system function and related diseases.

Rabbit polyclonal PSMB7 antibody

Affinity purified Rabbit polyclonal RAP2C antibody

PPIE antibody was raised using a synthetic peptide corresponding to a region with amino acids KKFSGKTLEENKEEEGSEPPKAETQEGEPIAKKARSNPQVYMDIKIGNKP

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.