Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75562 products of "Primary Antibodies"
VEGFC antibody
The VEGFC antibody is a monoclonal antibody that targets and neutralizes the activity of Vascular Endothelial Growth Factor C (VEGFC). This antibody plays a crucial role in inhibiting the activation of TNF-α, leukemia inhibitory factor, and other oncogenic kinases. By binding to VEGFC, this antibody prevents its interaction with its receptors, thereby inhibiting the signaling pathways involved in angiogenesis and lymphangiogenesis.
MCM7 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the rifamycin class. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. Through its binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth by preventing transcription and replication. The efficacy of this drug has been demonstrated through patch-clamp technique studies on human erythrocytes. Metabolically, it undergoes various transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture.
SURF6 antibody
SURF6 antibody was raised using the N terminal of SURF6 corresponding to a region with amino acids ICSHSAPEQQARTRAGKTQGSETAGPPKKKRKKTQKKFRKREEKAAEHKA
CPS1 antibody
CPS1 antibody was raised using the N terminal of CPS1 corresponding to a region with amino acids QWLQEEKVPAIYGVDTRMLTKIIRDKGTMLGKIEFEGQPVDFVDPNKQNL
CHRNA5 antibody
CHRNA5 antibody was raised using the middle region of CHRNA5 corresponding to a region with amino acids DGSQVDIILEDQDVDKRDFFDNGEWEIVSATGSKGNRTDSCCWYPYVTYS
TMEM59L antibody
TMEM59L antibody was raised using the N terminal of TMEM59L corresponding to a region with amino acids PAASAPSARDPFAPQLGDTQNCQLRCRDRDLGPQPSQAGLEGASESPYDR
SOX13 antibody
The SOX13 antibody is a highly specialized monoclonal antibody that targets the SOX13 protein. This protein is involved in various cellular processes, including nephrotoxicity, fibrinogen production, and regulation of endogenous hematopoietic stem cells. The SOX13 antibody has been extensively studied in Life Sciences research and has shown promising results in inhibiting the activity of this protein.
FICD antibody
FICD antibody was raised using the C terminal Of Ficd corresponding to a region with amino acids FAALAHYKLVYIHPFIDGNGRTSRLLMNLILMQAGYPPITIRKEQRSDYY
AURKA antibody
The AURKA antibody is a monoclonal antibody that targets glial fibrillary acidic protein (GFAP). It is commonly used in research and diagnostics to detect the presence of GFAP, which is an important marker for astrocytes. This antibody can be used in various applications, including immunohistochemistry, western blotting, and flow cytometry. Additionally, it has been shown to be effective in detecting amyloid plaques in Alzheimer's disease brain tissue. The AURKA antibody is also useful for studying the role of protein kinases in cellular processes, as it specifically targets Aurora kinase A (AURKA). It can be used as a tool to inhibit the activity of AURKA and study its downstream effects on cell division and proliferation. In summary, the AURKA antibody is a valuable tool for researchers in the life sciences field who are studying various aspects of cellular biology and disease mechanisms.
GCNT3 antibody
GCNT3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AICVYGAGDLNWMLQNHHLLANKFDPKVDDNALQCLEEYLRYKAIYGTEL
TRIM32 antibody
The TRIM32 antibody is a powerful tool used in the field of Life Sciences. It is an antibody that specifically targets and binds to TRIM32, a protein involved in various cellular processes. This antibody has been extensively studied and proven to be effective in various applications.
FZD9 antibody
FZD9 antibody was raised using a synthetic peptide corresponding to a region with amino acids RPPGDLGPGAGGSGTCENPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDF
CtBP2 antibody
The CtBP2 antibody is a highly specific and sensitive tool used in life sciences research. It is a polyclonal antibody that specifically detects CtBP2, a protein involved in various cellular processes. This antibody has been extensively validated and shown to have high affinity and specificity for its target.
CDY1 antibody
CDY1 antibody was raised using the C terminal of CDY1 corresponding to a region with amino acids FPRTWWQSAEDVHREKIQLDLEAEFYFTHLIVMFKSPRPAAMVLDRSQDF
XRCC4 antibody
The XRCC4 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the XRCC4 protein, which plays a crucial role in DNA repair and recombination. The antibody binds to the histidine-tagged XRCC4 protein, allowing for its detection and analysis in various experimental settings. This XRCC4 antibody is commonly used in studies involving pluripotent cells, collagen synthesis, lipoprotein lipase regulation, and immune response modulation. Additionally, it has been shown to interact with other proteins such as interferon, TGF-beta, and endothelial growth factors. The XRCC4 antibody offers researchers a valuable tool for investigating DNA repair mechanisms and understanding their implications in various biological processes.
LGALS14 antibody
LGALS14 antibody was raised using the N terminal of LGALS14 corresponding to a region with amino acids MSSLPVPYTLPVSLPVGSCVIITGTPILTFVKDPQLEVNFYTGMDEDSDI
Histone H2Ax antibody
The Histone H2Ax antibody is a highly specialized monoclonal antibody used in Life Sciences research. This antibody specifically targets and binds to the acidic histone protein H2Ax, which plays a crucial role in DNA repair and damage response. By detecting the presence of H2Ax, researchers can gain valuable insights into various cellular processes, including fibrinogen activation, growth factor signaling, and multidrug resistance.
Thyroid Peroxidase antibody
Thyroid Peroxidase antibody is a monoclonal antibody used in Life Sciences research. It targets the thyroid peroxidase enzyme, which plays a crucial role in thyroid hormone synthesis. This antibody can be used to study the regulation and function of thyroid peroxidase, as well as its involvement in autoimmune thyroid diseases. Additionally, Thyroid Peroxidase antibody has been shown to have growth factor-like activity and can activate various signaling pathways. It has also been found to be involved in the glycosylation of proteins, including fibrinogen. Furthermore, this antibody has potential diagnostic applications as it can detect autoantibodies against thyroid peroxidase, which are often present in patients with autoimmune thyroid disorders. Overall, Thyroid Peroxidase antibody is a valuable tool for researchers studying thyroid biology and related diseases.
GPR120 antibody
The GPR120 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It acts as a growth factor and has the ability to neutralize epidermal growth factor (EGF) and TGF-beta. This antibody is widely used in research laboratories and pharmaceutical companies for its inhibitory properties. It specifically targets GPR120, a receptor protein that plays a crucial role in fatty acid metabolism. The GPR120 antibody can be used to study the activation of this receptor and its downstream signaling pathways. Additionally, it has been proven effective in detecting c-myc expression and alpha-fetoprotein levels. With its high specificity and reliability, the GPR120 antibody is an essential tool for researchers working in various fields of study within Life Sciences.
p53 antibody
The p53 antibody is a highly effective inhibitor used in Life Sciences research. This monoclonal antibody specifically targets and neutralizes the p53 protein, which plays a crucial role in regulating cell growth and preventing tumor formation. By blocking the activity of p53, this antibody can be used to study the molecular mechanisms involved in cell cycle control, DNA repair, and apoptosis. Additionally, it has been shown to enhance the cytotoxic effects of certain chemotherapeutic agents and interferon. With its high specificity and potency, the p53 antibody is a valuable tool for studying the function of this important tumor suppressor protein.
Endomucin antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, thereby inhibiting bacterial growth and preventing transcription and replication. In addition, it has been extensively studied using advanced techniques like patch-clamp technique on human erythrocytes. The metabolism of this drug involves various transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Furthermore, it specifically targets markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture.
Ubiquitin antibody (Prediluted for IHC)
Rabbit polyclonal Ubiquitin antibody (Prediluted for IHC)
Purity:Min. 95%CDCA5 antibody
CDCA5 antibody was raised using the middle region of CDCA5 corresponding to a region with amino acids ATPTSTPVPNPEAESSSKEGELDARDLEMSKKVRRSYSRLETLGSASTST
STAT1 antibody
The STAT1 antibody is a highly specialized antibody used in the field of Life Sciences. It is designed to target and bind to the STAT1 protein, which plays a crucial role in cellular signaling pathways. This antibody can be used for various applications such as immunohistochemistry, western blotting, and flow cytometry.
Purity:Min. 95%Goat anti Human IgG (Fab'2) (PE)
Goat anti-human IgG (Fab'2) (PE) was raised in goat using human IgG F(c) fragment as the immunogen.Purity:Min. 95%Scamp5 antibody
Scamp5 antibody was raised in rabbit using the C terminal of Scamp5 as the immunogen
Purity:Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%HBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productCA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
