Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75562 products of "Primary Antibodies"
Cathepsin F antibody
The Cathepsin F antibody is a polyclonal antibody that specifically targets and binds to Cathepsin F, an acidic cysteine protease. Cathepsin F plays a crucial role in various physiological processes, including the degradation of extracellular matrix components such as fibronectin and collagen. This antibody is highly specific and can be used in various life science applications, including immunohistochemistry, Western blotting, and ELISA.
gp340 antibody
The gp340 antibody is a highly specialized monoclonal antibody that is designed to target and neutralize specific proteins in the body. It has been extensively tested and proven effective in various research studies conducted by Life Sciences professionals. This antibody specifically targets influenza hemagglutinin, a protein that plays a crucial role in the growth and spread of the influenza virus.
ACTH (1-24) antibody
ACTH (1-24) antibody was raised in sheep using ACTH 1-24 conjugated to thyroglobulin as the immunogen.Purity:Min. 95%TSTA3 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth, preventing transcription and replication. Its efficacy has been demonstrated through patch-clamp techniques on human erythrocytes. Metabolized through various transformations, such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid, it specifically targets Mycobacterium tuberculosis strains and inhibits their cell growth.
LNX1 antibody
LNX1 antibody was raised using the C terminal of LNX1 corresponding to a region with amino acids SHREWDLPIYVISVEPGGVISRDGRIKTGDILLNVDGVELTEVSRSEAVA
SLC26A10 antibody
SLC26A10 antibody was raised in rabbit using the N terminal of SLC26A10 as the immunogen
Purity:Min. 95%Chicken anti Mouse IgG (H + L) (rhodamine)
This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.Purity:Min. 95%AQP1 antibody
The AQP1 antibody is a monoclonal antibody that targets the aquaporin-1 (AQP1) protein. Aquaporins are a family of water channel proteins that play a crucial role in regulating water transport across cell membranes. AQP1 is specifically expressed in endothelial cells, where it facilitates the movement of water and small solutes across blood vessels.
Goat anti Human IgG (rhodamine)
Goat anti-human IgG (Rhodamine) was raised in goat using human IgG heavy chain as the immunogen.
Purity:Min. 95%CYP2A13 antibody
CYP2A13 antibody was raised using the C terminal of CYP2A13 corresponding to a region with amino acids DPRFFSNPRDFNPQHFLDKKGQFKKSDAFVPFSIGKRYCFGEGLARMELF
Rat gamma 2B Heavy Chain antibody
Rat gamma 2B heavy chain antibody was raised in mouse using rat IgG2b as the immunogen.
FAST antibody
The FAST antibody is a hormone peptide that plays a crucial role in various biological processes. This antibody specifically targets multidrug resistance-associated protein (MRP), which is involved in drug resistance mechanisms in cancer cells. The FAST antibody has been extensively studied and has shown promising results in inducing apoptosis (cell death) in cancer cells by targeting MRP. It is available as both polyclonal and monoclonal antibodies, providing researchers with options for their specific experimental needs. Additionally, the FAST antibody can be used in various applications such as immunohistochemistry, Western blotting, and flow cytometry. Its ability to specifically bind to MRP makes it a valuable tool for studying drug resistance mechanisms and developing novel therapeutic strategies against cancer.
MCM7 antibody
The MCM7 antibody is a highly specialized antibody that targets the lipoprotein lipase, an enzyme involved in the breakdown of triglycerides. This polyclonal antibody is widely used in the field of Life Sciences for research purposes and has shown great potential as an antibiotic. It specifically binds to the lipoprotein lipase, inhibiting its activity and preventing the breakdown of triglycerides. Additionally, this antibody has been found to have growth factor-like properties, promoting cell proliferation and differentiation. The MCM7 antibody is available as both monoclonal and polyclonal antibodies, allowing researchers to choose the most suitable option for their experiments. Its high specificity and cytotoxic effects make it a valuable tool in studying adipose tissue metabolism, collagen synthesis, and TGF-beta signaling pathways.
GGT2 antibody
GGT2 antibody was raised in rabbit using the N terminal of GGT2 as the immunogen
Purity:Min. 95%Endostatin antibody
Endostatin antibody was raised in Mouse using recombinant endostatin as the immunogen.Purity:≥85% By Sds-PageKLRG1 antibody (biotin)
KLRG1 antibody (biotin) was raised in hamster using activated NK (A-LAK) cells from B6 mice as the immunogen.
Purity:Min. 95%IL16 antibody
IL16 antibody is a highly effective polyclonal antibody that specifically targets IL16, a cytokine involved in immune response regulation. This antibody recognizes and binds to the amino group of IL16, neutralizing its activity and preventing it from interacting with its receptors. The IL16 antibody can be used in various research applications, including immunohistochemistry, Western blotting, and flow cytometry. It has been shown to inhibit the growth and proliferation of mesenchymal stem cells and has potential therapeutic applications in cancer treatment. Additionally, this antibody has been used as a tool in studying the role of IL16 in diseases such as asthma, rheumatoid arthritis, and HIV infection. With its high specificity and effectiveness, the IL16 antibody is a valuable tool for researchers in the life sciences field.
Atp11c antibody
Atp11c antibody was raised in rabbit using the C terminal of Atp11c as the immunogenPurity:Min. 95%SUCLG2 antibody
The SUCLG2 antibody is a highly specialized monoclonal antibody that specifically binds to SUCLG2, a protein involved in cellular metabolism. This antibody can be used in various research applications, including immunohistochemistry and protein-protein interaction studies. It has been shown to effectively detect and quantify SUCLG2 levels in different cell types and tissues. The binding of the SUCLG2 antibody to its target protein can lead to downstream effects such as interference with chemokine signaling pathways or cytotoxic activity. Additionally, this antibody can be used in antibody-drug conjugate strategies, where it is conjugated to a cytotoxic compound for targeted therapy. Overall, the SUCLG2 antibody is a valuable tool for researchers in the Life Sciences field who are studying cellular metabolism and its implications in various diseases and conditions.
CGRP antibody
CGRP antibody was raised in guinea pig using calcitonin gene-related peptide conjugated to BSA as the immunogen.Purity:Min. 95%Hexokinase Type 1 antibody
Hexokinase type 1 antibody was raised in mouse using rat type I hexokinase as the immunogen.
USP15 antibody
The USP15 antibody is a trifunctional antibody that has multiple applications in the field of Life Sciences. This antibody specifically targets and binds to USP15, which is an enzyme involved in the regulation of various cellular processes. The USP15 antibody can be used for research purposes, such as studying the role of USP15 in different signaling pathways or investigating its interaction with other proteins.
GALNT7 antibody
The GALNT7 antibody is a highly specific polyclonal antibody that targets GALNT7, an enzyme responsible for adding sugar molecules to proteins. This antibody recognizes specific acid residues in GALNT7 and can be used for various applications in life sciences research. It has been extensively validated and shown to have high affinity and specificity for GALNT7.
GPR171 antibody
The GPR171 antibody is a highly specialized monoclonal antibody that targets the GPR171 receptor. This receptor plays a crucial role in various biological processes, including erythropoietin signaling, TNF-α production, chemokine regulation, and microvessel density. The GPR171 antibody has been extensively studied and proven to be highly effective in neutralizing the activity of GPR171.
Donkey anti Guinea Pig IgG (H + L) (HRP)
Donkey anti-guinea pig IgG (H + L) (HRP) was raised in donkey using guinea pig IgG (H & L) as the immunogen.
Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productHBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%CA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
