Primary Antibodies

Affinity purified Mouse polyclonal GBP1 antibody

The GPR132 antibody is a highly specialized chemokine that is activated in human serum. It is widely used in the field of Life Sciences and Antibodies for its ability to target specific growth factors, such as alpha-fetoprotein, and adipose tissues. This monoclonal antibody has a neutralizing effect on receptor binding, making it an effective tool for blocking specific pathways. The GPR132 antibody is commonly used in research settings, where it can be conjugated with colloidal phosphatase or other markers to facilitate detection. Its versatility and effectiveness make it an invaluable tool for studying various biological processes and identifying potential therapeutic targets.

GADD45A antibody was raised in rabbit using the C terminal of GADD45A as the immunogen

Complement C1q antibody was raised in mouse using human complement C1q as the immunogen.

ZNF364 antibody was raised using the C terminal Of Znf364 corresponding to a region with amino acids PWLELHDTCPVCRKSLNGEDSTRQSQSTEASASNRFSNDSQLHDRWTF

HCN3 antibody was raised in Rabbit using Human HCN3 as the immunogen

SPSB2 antibody was raised in rabbit using the N terminal of SPSB2 as the immunogen

Affinity purified Rabbit polyclonal C20orf11 antibody

The PGP9.5 antibody is a highly specific and sensitive tool used in life sciences research. It is a polyclonal antibody that targets the protein gene product 9.5 (PGP9.5), also known as ubiquitin carboxyl-terminal hydrolase L1 (UCHL1). This antibody recognizes and binds to PGP9.5, allowing for its detection and quantification in various biological samples.

Rabbit polyclonal CLCN6 antibody

COL6A1 antibody was raised in Rabbit using Human COL6A1 as the immunogen

Goat anti-human IgG (Alk Phos) was raised in goat using human IgG F(c) fragment as the immunogen.

Rabbit polyclonal FABP antibody (Cardiac) (HRP)

The CtIP antibody is a powerful diagnostic agent that is used in Life Sciences research. It acts as a parp inhibitor, which means it inhibits the activity of poly(ADP-ribose) polymerase (PARP), an enzyme involved in DNA repair. This antibody is luminescent and can be detected using particle chemiluminescence or other detection methods. It specifically targets CtIP, a protein involved in DNA recombination and repair, making it an essential tool for studying these processes. The CtIP antibody can be conjugated to streptavidin or magnetic particles for easy detection and purification. Whether you are conducting research or developing new therapies, this antibody is a valuable tool for understanding and manipulating cellular processes.

Affinity purified Rabbit polyclonal Nucleoporin p62 antibody

The RARG antibody is a monoclonal antibody that targets the retinoic acid receptor gamma (RARG). It belongs to the family of tyrosine kinase inhibitors and acts as a cytotoxic agent by inhibiting the growth of endothelial cells. This antibody has been extensively studied in Life Sciences research and has shown promising results in neutralizing the effects of growth factors such as trastuzumab and vascular endothelial growth factor (VEGF). Additionally, it has been found to have an inhibitory effect on tyrosinase, an enzyme involved in melanin production. The RARG antibody can be used in various applications, including immunohistochemistry, western blotting, and ELISA assays. With its potential therapeutic applications, this antibody is a valuable tool for researchers and clinicians alike.

ECEL1 antibody was raised in Rabbit using Human ECEL1 as the immunogen

Rabbit polyclonal PNRC2 antibody

FCAMR antibody was raised in rabbit using the C terminal of FCAMR as the immunogen

ENOPH1 antibody was raised using the N terminal of ENOPH1 corresponding to a region with amino acids IEENVKEYLQTHWEEEECQQDVSLLRKQAEEDAHLDGAVPIPAASGNGVD

Rat monoclonal CCR7 antibody (allophycocyanin)

Affinity purified Rabbit polyclonal Galanin Receptor 2 antibody

Rabbit polyclonal PGBD3 antibody

Rabbit polyclonal PRPS1 antibody

CCNG1 antibody was raised in Rabbit using Human CCNG1 as the immunogen

Please enquire for more information about Murine Anti-HIV-1 p24 monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

The GPR171 antibody is a highly specialized monoclonal antibody that targets the GPR171 receptor. This receptor plays a crucial role in various biological processes, including erythropoietin signaling, TNF-α production, chemokine regulation, and microvessel density. The GPR171 antibody has been extensively studied and proven to be highly effective in neutralizing the activity of GPR171.

MEIS3 antibody was raised in Rabbit using Human MEIS3 as the immunogen

MLXIP antibody was raised in Rabbit using Human MLXIP as the immunogen

The SMAD antibody is a highly specific monoclonal antibody that targets the SMAD protein, an important regulator of cellular processes. This antibody is widely used in Life Sciences research to study various cellular pathways and signaling cascades. It specifically recognizes the nuclear localization of SMAD and inhibits its function by blocking its interaction with other proteins. The SMAD antibody has been extensively validated for use in immunohistochemistry, western blotting, and other molecular biology techniques. It is a valuable tool for researchers studying cell antigens, glycosylation, exocytosis, and phosphatase activity. Whether you are investigating the role of SMAD in cancer development or studying the effects of interleukin-6 on cellular processes, the SMAD antibody is an essential component of your research toolkit. Choose this high-quality polyclonal antibody to ensure accurate and reliable results in your experiments.

The CD66b antibody is a monoclonal antibody that has a stimulatory effect on epidermal growth factor (EGF) signaling. It binds to the CD66b antigen, which is expressed on activated immune cells. This binding leads to the dephosphorylation of EGF receptors and enhances their signaling activity. The CD66b antibody can be used in various life science applications, such as immunohistochemistry, flow cytometry, and Western blotting. It can also be used for hybridization studies and to detect autoantibodies. Additionally, the CD66b antibody can be conjugated with other molecules, such as enzymes or fluorescent dyes, to facilitate detection and visualization in experiments. Whether you're studying mitogen-activated protein (MAP) kinase pathways or investigating receptor binding and interferon signaling, the CD66b antibody is an essential tool for your research needs. Choose from a range of formats, including chimeric proteins and polyclonal antibodies, to

The DECR1 antibody is a highly specialized peptide agent used in Life Sciences research. It is designed to target and neutralize antiphospholipid antibodies, which are reactive molecules found in human serum. This antibody exhibits catalase activity, making it an effective tool for studying the function of catalase enzymes. Additionally, the DECR1 antibody has been shown to bind to basic proteins and globulins, further expanding its potential applications in various research fields. As a glycoprotein with anticoagulant properties, this antibody can be used to investigate the role of autoantibodies in coagulation disorders. Researchers rely on the specificity and reliability of the DECR1 antibody to advance their understanding of complex biological processes.

The RED antibody is a monoclonal antibody that specifically targets erythropoietin (EPO). It is designed to neutralize the activity of EPO by inhibiting its endocytic uptake. This antibody has been extensively used in immunoassays to detect and quantify EPO levels in various biological samples. The RED antibody is highly specific and exhibits minimal cross-reactivity with other proteins or molecules. It is produced using state-of-the-art technology and undergoes rigorous quality control to ensure its effectiveness and reliability. In addition, the RED antibody is formulated with excipients that enhance its stability and shelf life. Whether you are conducting research in Life Sciences or developing therapeutic agents, the RED antibody can be a valuable tool for studying EPO-related processes, such as erythropoiesis or the interaction of EPO with human endothelial cells. Its use can also help elucidate the role of EPO in various physiological and pathological conditions. With its high affinity and neutralizing properties, the RED

Rabbit polyclonal argF antibody (HRP)

Rabbit polyclonal COX5B antibody (biotin)

The CKS2 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and neutralize the toxic effects of colony-stimulating factors, which are proteins that regulate the production and differentiation of white blood cells. The CKS2 antibody specifically targets the phosphatase activity of colony-stimulating factors, inhibiting their ability to stimulate cell growth and division.

Affinity purified Rabbit polyclonal RAD1 antibody

Syrian Hamster monoclonal NK cell antibody (PE)

The PSPH antibody is a monoclonal antibody produced by a hybridoma cell strain. It is designed to specifically target and bind to the PSPH protein, which plays a crucial role in various biological processes. The antibody can be used in life sciences research, diagnostic assays, and therapeutic applications.

SLC22A18 antibody was raised using the middle region of SLC22A18 corresponding to a region with amino acids IQCPAILAALATLLGAVLSFTCIPASTKGAKTDAQAPLPGGPRASVFDLK

Mouse monoclonal SCHIP1 antibody

CLIC4 antibody was raised using the N terminal of CLIC4 corresponding to a region with amino acids LSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVF

Met antibody is a polyclonal antibody that specifically targets the tyrosine kinase receptor known as c-Met. This antibody has neutralizing properties, meaning it can inhibit the activity of c-Met and its downstream signaling pathways. By binding to the protein complex formed by c-Met and its ligand, this antibody prevents the activation of various cellular processes involved in cell growth, survival, migration, and invasion.

The Syntaxin 5 antibody is a highly specialized neurotrophic factor that plays a crucial role in various biological processes. This antibody is designed to specifically target and bind to the Syntaxin 5 protein, which is involved in the regulation of chemokine activity and the activation of interferon and insulin signaling pathways.

Purified Polyclonal PLA2G4C antibody

MPP7 antibody was raised in Rabbit using Human MPP7 as the immunogen

The NOB1 antibody is a cytotoxic antibody-drug that specifically targets the tyrosine residues in the nuclear region of cells. This antibody has been shown to inhibit the production of interleukin-6 (IL-6), a pro-inflammatory cytokine, by binding to its cell surface antigen. Additionally, the NOB1 antibody has hemagglutinin activity and can bind to alpha-gal and transferrin receptors on cells. The glycosylation of this antibody enhances its stability and prolongs its half-life in circulation. This product is widely used in life sciences research and is available as polyclonal antibodies for various applications. With its high specificity and potency, the NOB1 antibody is an essential tool for studying cellular processes and immune responses.

The SEMA4A antibody is a polyclonal antibody that specifically targets the protein SEMA4A, which belongs to the family of costimulatory molecules. This antibody can be used in various life sciences applications, including immunomodulatory research and dendritic cell studies. By binding to SEMA4A, this antibody can inhibit its interaction with membrane-bound receptors, thereby modulating immune responses. The SEMA4A antibody is a valuable tool for researchers studying the role of costimulatory molecules in immune regulation and developing novel immunotherapies.

The HAVCR1 antibody is a polyclonal antibody that targets the protein known as HAVCR1. This antibody plays a crucial role in various biological processes, including caspase-9 activation, nuclear factor kappa-light-chain-enhancer of activated B cells (NF-κB) signaling pathway, β-catenin stabilization, and p38 mitogen-activated protein kinase (MAPK) activation.

Affinity purified Rabbit polyclonal RanBP16 antibody

FAM161A antibody was raised in rabbit using the C terminal of FAM161A as the immunogen

Rabbit polyclonal RuBisCO antibody (HRP)

Affinity purified Rabbit polyclonal Coronin 1C antibody

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.