Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75562 products of "Primary Antibodies"
Caspase 8 antibody
The Caspase 8 antibody is a highly specialized polyclonal antibody used in the field of Life Sciences. It plays a crucial role in various biological processes, including natriuretic regulation, growth factor signaling, and medicament development. This antibody specifically targets caspase 8, an enzyme involved in cellular apoptosis.
Thyroid Peroxidase antibody
Thyroid Peroxidase antibody is a monoclonal antibody that targets the thyroid peroxidase enzyme. This enzyme plays a crucial role in the synthesis of thyroid hormones. By binding to the enzyme, Thyroid Peroxidase antibody inhibits its activity, leading to a decrease in thyroid hormone production. This antibody has been extensively used in research and diagnostic applications in the field of Life Sciences. It has shown great potential for studying cholinergic signaling pathways, genotoxic effects, fatty acid metabolism, and neutralizing specific proteins such as collagen and acetylcholine. With its high specificity and affinity, Thyroid Peroxidase antibody is an essential tool for researchers working in various areas of biology and medicine.MTHFD2 antibody
MTHFD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LPLPEHIDERRICNAVSPDKDVDGFHVINVGRMCLDQYSMLPATPWGVWE
COL1A1 antibody
The COL1A1 antibody is a polyclonal antibody that specifically targets collagen type I alpha 1 chain. It can be used in various research applications, including immunohistochemistry and western blotting. This antibody plays a crucial role in the study of lipoprotein lipase and its interaction with collagen. Additionally, it has been shown to have potential therapeutic applications in diseases such as trastuzumab-resistant breast cancer.
Amylin antibody
The Amylin antibody is a powerful tool in the field of Life Sciences. This antibody has the ability to interfere with e-cadherin expression, making it an essential component for research related to cell adhesion and migration. It is available in both polyclonal and monoclonal forms, offering researchers flexibility in their experimental design.
FGFR2 antibody
The FGFR2 antibody is a polyclonal antibody that targets the FGFR2 protein. It is commonly used in research and diagnostic applications in the field of Life Sciences. This antibody specifically recognizes the endogenous hematopoietic FGFR2 protein and can be used to detect its expression levels in various samples, such as human serum or tissue lysates.
RBP1 antibody
The RBP1 antibody is a monoclonal antibody that specifically targets the TGF-beta1 protein. It can be used in various research applications in Life Sciences, such as studying the effects of TGF-beta1 on cellular processes and signaling pathways. The RBP1 antibody has been shown to neutralize the activity of TGF-beta1, which plays a crucial role in cell growth, differentiation, and immune response regulation. Additionally, this antibody can be used in combination with other antibodies or drugs, such as imatinib or interferon, to investigate potential synergistic effects. Its high specificity and affinity make it an excellent tool for studying TGF-beta1-related mechanisms and developing therapeutic interventions.
Connexin 43 antibody
The Connexin 43 antibody is a highly specialized antibody used in Life Sciences research. It targets the protein Connexin 43, which plays a crucial role in cell communication and signaling. This antibody is available in both polyclonal and monoclonal forms.
GST antibody
The GST antibody is a cholinergic monoclonal antibody used in Life Sciences research. It specifically targets and binds to the glutathione S-transferase (GST) protein, which is involved in various cellular processes. This antibody is commonly used in studies related to alpha-fetoprotein, cryptosporidium, adeno-associated virus, activated epidermal growth factor, β-catenin, steroid acetyltransferase, and electrode research. The GST antibody has been extensively tested and validated for its specificity and sensitivity in detecting GST protein in various samples, including human serum. Researchers rely on this antibody to accurately analyze the expression and localization of GST protein in their experiments. Its high-quality performance makes it an essential tool for studying the functions and interactions of GST in different biological systems.
Tropomyosin 1 antibody
Tropomyosin 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids DRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQE
PINX1 antibody
The PINX1 antibody is a powerful tool used in life sciences research. It is a polyclonal antibody that specifically targets and neutralizes the PINX1 protein. This protein is found in various tissues, including liver microsomes, and plays a role in regulating important cellular processes such as dopamine signaling, oncostatin production, and β-catenin localization within the nucleus.
AKR1C1 antibody
AKR1C1 antibody was raised in mouse using recombinant human AKR1C1 (1-323aa) purified from E. coli as the immunogen.
C1R antibody
The C1R antibody is a highly specialized protein that plays a crucial role in various life sciences applications. This antibody is specifically designed to target and neutralize the activity of certain proteins, such as growth factors and autoantibodies, which are involved in various biological processes.
KCNQ2 antibody
KCNQ2 antibody was raised using the middle region of KCNQ2 corresponding to a region with amino acids GNVFATSALRSLRFLQILRMIRMDRRGGTWKLLGSVVYAHSKELVTAWYI
ZO1 antibody
The ZO1 antibody is a highly effective monoclonal antibody that specifically targets CD33, a cell surface protein. This antibody is widely used in the field of life sciences for various applications. It has been shown to inhibit the growth of cancer cells, such as MCF-7 breast cancer cells, by blocking the action of growth factors and interfering with cell signaling pathways. Additionally, the ZO1 antibody has been used in research involving mesenchymal stem cells to study their differentiation potential and therapeutic applications. Furthermore, this antibody can be utilized in immunohistochemistry and western blotting assays to detect and quantify specific proteins of interest. With its exceptional specificity and sensitivity, the ZO1 antibody is an invaluable tool for scientists and researchers in their quest for new discoveries in the field of molecular biology.
Prolactin Receptor antibody
The Prolactin Receptor antibody is a growth factor that belongs to the class of monoclonal antibodies. It has neutralizing properties and can effectively inhibit the activity of prolactin, a hormone involved in lactation and reproductive functions. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research applications.
MMP1 antibody
MMP1 antibody was raised in mouse using a synthetic peptide (VQGQNVLHGYPKDIYSSFG) corresponding to amino acid residues 332-350 0f human MMP-1 as the immunogen.
ZC3H12A antibody
The ZC3H12A antibody is a polyclonal antibody that is used in life sciences research. It has been shown to interact with various proteins and molecules, including alpha-fetoprotein, macrophage colony-stimulating factor, interferon, phosphatase, acidic glutamate, and vasoactive intestinal peptide. This antibody is commonly used in studies related to immune response and cell signaling pathways. It specifically targets the ZC3H12A protein, which is known to play a role in regulating inflammatory responses. The ZC3H12A antibody can be used for various applications such as immunohistochemistry, western blotting, and enzyme-linked immunosorbent assays (ELISA). Its high specificity and sensitivity make it a valuable tool for researchers studying immune system function and related diseases.
BRAF antibody
BRAF antibody was raised in Mouse using a purified recombinant fragment of BRAF expressed in E. coli as the immunogen.Goat anti-Human IgG antibody
The Goat anti-Human IgG antibody is a powerful tool used in Life Sciences research. This monoclonal antibody specifically targets and neutralizes human IgG, making it an essential component for various applications.
SLC12A2 antibody
SLC12A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids IIAFEEIIEPYRLHEDDKEQDIADKMKEDEPWRITDNELELYKTKTYRQI
STK11 antibody
STK11 antibody was raised using the N terminal of STK11 corresponding to a region with amino acids TLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNE
GFAP antibody
The GFAP antibody is a monoclonal antibody that specifically targets the glial fibrillary acidic protein (GFAP). It is widely used in various life sciences applications, including immunoassays and protein detection. This antibody can be used to detect and quantify GFAP levels in various samples, such as human serum or tissue lysates. The GFAP antibody has been shown to inhibit the activity of phosphatase enzymes that are involved in signal transduction pathways. It is also conjugated to magnetic particles, allowing for easy purification and separation of the target molecule. Additionally, this antibody has been found to react with actin filaments, providing valuable insights into cellular structure and function. With its high specificity and sensitivity, the GFAP antibody is an essential tool for researchers studying glial cells and their role in various physiological processes.
HBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productCA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
