Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75594 products of "Primary Antibodies"
Factor VII antibody (FITC)
Factor VII antibody (FITC) was raised in sheep using human Factor VII purified from plasma as the immunogen.HLADR antibody
The HLADR antibody is a highly specialized monoclonal antibody that is used in the field of Life Sciences. It is designed to specifically bind to the HLADR receptor, which plays a crucial role in immune system function. This antibody has been extensively tested and shown to have high affinity and specificity for its target.
TIMP1 antibody
The TIMP1 antibody is a highly specific and sensitive tool used in Life Sciences research. It is an antibody that specifically targets and binds to TIMP1, which stands for Tissue Inhibitor of Metalloproteinase 1. TIMP1 is a protein that plays a crucial role in regulating the activity of enzymes known as metalloproteinases, which are involved in various biological processes including tissue remodeling, angiogenesis, and cell migration.
CD19 antibody (Azide Free)
CD19 antibody (Azide free) was raised in mouse using human CD19 as the immunogen.
HBcAg antibody
The HBcAg antibody is a reactive antibody that is used in various applications in the field of life sciences. It is commonly used for its neutralizing properties against antiphospholipid antibodies and anti-HER2 antibodies. This polyclonal antibody has been extensively studied and has shown high specificity and affinity towards its target antigens.
MCM3 antibody
The MCM3 antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets MCM3, a protein biomarker involved in various cellular processes. This antibody can be used in immunoassay tests to detect and quantify MCM3 levels in samples, providing valuable insights into cell cycle regulation, DNA replication, and other essential biological functions.
APP antibody
The APP antibody is a powerful tool used in medical research and diagnostics. It specifically targets alpha-fetoprotein (AFP), which is an important biomarker for various diseases, including liver cancer. The APP antibody binds to amyloid plaques, which are abnormal protein deposits found in the brains of individuals with Alzheimer's disease. This antibody can also be used to study growth factors and their binding proteins, providing valuable insights into cellular processes and signaling pathways.
IFITM1 antibody
The IFITM1 antibody is a chemokine that plays a crucial role in immune response modulation. It is a polyclonal antibody that specifically targets the proprotein encoded by the IFITM1 gene. This antibody can be used for various applications in life sciences, including research and diagnostic purposes.
GLUT4 antibody
The GLUT4 antibody is a polyclonal antibody used in the life sciences field. It specifically targets binding proteins involved in the regulation of glucose transport. This antibody has been extensively tested and validated for its specificity and sensitivity. It has been shown to effectively detect GLUT4 expression in various tissues and cell types.
APCS antibody
APCS antibody was raised using the N terminal of APCS corresponding to a region with amino acids NFTLCFRAYSDLSRAYSLFSYNTQGRDNELLVYKERVGEYSLYIGRHKVT
PFK antibody
The PFK antibody is a highly specialized polymerase enzyme that acts as a neutralizing agent. It is a monoclonal antibody specifically designed to target collagen and inhibit its activity. This antibody has shown great potential in the field of Life Sciences, particularly in research related to TGF-beta1, albumin, phosphatase, growth factors, interferon, glutamate, and dopamine. Its unique mechanism of action makes it an invaluable tool for studying various biological processes and pathways. Whether you're conducting experiments or exploring new therapeutic avenues, the PFK antibody is sure to be an asset in your scientific endeavors.
GPR45 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting the active compounds responsible for its growth. This bactericidal activity is achieved by binding to DNA-dependent RNA polymerase, effectively preventing transcription and replication. Extensive research has been conducted using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique to confirm its high efficacy on human erythrocytes. Metabolically, this drug undergoes various transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it exhibits a strong affinity for markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture. Experience the power of 6-Fluoro
Ibuprofen antibody
The Ibuprofen antibody is a highly specialized antibody that targets and binds to Ibuprofen, a popular nonsteroidal anti-inflammatory drug (NSAID). This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research applications.
NOD2 antibody
The NOD2 antibody is a highly specialized protein used in the field of Life Sciences. It acts as an inhibitory factor for growth factors such as epidermal growth factor and hepatocyte growth factor. This monoclonal antibody specifically targets NOD2, a receptor involved in immune responses and inflammation. By binding to NOD2, the antibody blocks its function and prevents the activation of downstream signaling pathways. This antibody has been extensively studied and shown to be effective in various research applications, including the study of autoimmune diseases, cancer biology, and immunology. Whether you need a polyclonal or monoclonal antibody, our high-quality NOD2 antibodies are reliable tools for your research needs.
Claudin 17 antibody
Claudin 17 antibody was raised using the middle region of CLDN17 corresponding to a region with amino acids KQVQCTGSNERAKAYLLGTSGVLFILTGIFVLIPVSWTANIIIRDFYNPA
RPE antibody
RPE antibody was raised using the middle region of RPE corresponding to a region with amino acids MMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIK
FARS2 antibody
FARS2 antibody was raised using the N terminal of FARS2 corresponding to a region with amino acids VELLGKSYPQDDHSNLTRKVLTRVGRNLHNQQHHPLWLIKERVKEHFYKQ
EGF antibody
The EGF antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets and neutralizes the activity of epidermal growth factor (EGF), a key regulator of cell growth and division. This antibody has been extensively studied and proven to be highly effective in inhibiting the activity of EGF and its downstream signaling pathways.
BCOR antibody
The BCOR antibody is a monoclonal antibody that specifically targets the necrosis factor-related apoptosis-inducing protein. This antibody has been widely used in Life Sciences research to study various biological processes, including amyloid plaque formation and cell death pathways. The BCOR antibody exhibits high specificity and affinity for its target and has been extensively characterized for its binding properties. It is also serum albumin-binding, which allows for efficient delivery and distribution in vivo. This antibody can be used in a variety of applications, such as immunohistochemistry, Western blotting, and ELISA assays. Whether you are studying erythropoietin signaling or investigating growth factors involved in low-density lipoprotein metabolism, the BCOR antibody is an invaluable tool for your research needs. Choose this highly reliable and validated monoclonal antibody to ensure accurate and reproducible results in your experiments.
CtBP2 antibody
The CtBP2 antibody is a highly specific and sensitive tool used in life sciences research. It is a polyclonal antibody that specifically detects CtBP2, a protein involved in various cellular processes. This antibody has been extensively validated and shown to have high affinity and specificity for its target.
CDY1 antibody
CDY1 antibody was raised using the C terminal of CDY1 corresponding to a region with amino acids FPRTWWQSAEDVHREKIQLDLEAEFYFTHLIVMFKSPRPAAMVLDRSQDF
RAP1 antibody
The RAP1 antibody is a highly effective monoclonal antibody that specifically targets and neutralizes the activated form of RAP1. This antibody has been extensively tested and proven to be highly efficient in various applications such as lysis, immobilization, and electrode-based assays. It is widely used in Life Sciences research for its ability to inhibit interferon-induced cytotoxicity and promote endothelial growth. The RAP1 antibody is also known for its high affinity towards anti-dnp antibodies, making it an excellent tool for detecting and quantifying these specific antibodies in human serum samples. With its exceptional specificity and reliability, the RAP1 antibody is a valuable asset for any researcher or scientist working in the field of immunology or molecular biology.
VWF antibody (HRP)
VWF antibody (HRP) was raised in sheep using Rat vWF purified from plasma as the immunogen.
MCL1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycins class. It is specifically designed to target tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug has been extensively studied using advanced techniques such as transcription-quantitative polymerase chain and patch-clamp technique, which have shown its efficacy in inhibiting bacterial growth. Additionally, it undergoes various metabolic transformations including hydrolysis by esterases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Its ability to bind to markers expressed in Mycobacterium tuberculosis strains further enhances its effectiveness in inhibiting cell growth.
PARP11 antibody
PARP11 antibody was raised using a synthetic peptide corresponding to a region with amino acids SAFSYICENEAIPMPPHWENVNTQVPYQLIPLHNQTHEYNEVANLFGKTM
Cartilage associated protein antibody
Affinity purified Rabbit polyclonal Cartilage associated protein antibody
ZHX2 antibody
The ZHX2 antibody is a protein reagent used in Life Sciences research. It is a polyclonal antibody that specifically targets and inhibits cytokines. This antibody is widely used in various experiments and studies to investigate the role of cytokines in different biological processes. With its high specificity and potency, the ZHX2 antibody is an essential tool for researchers in the field of immunology and molecular biology. Whether you are studying immune responses, inflammation, or cell signaling pathways, this antibody can provide valuable insights into the mechanisms underlying these processes. Trust the ZHX2 antibody to deliver reliable results and contribute to advancements in scientific knowledge.
SOCS3 antibody
The SOCS3 antibody is a biomaterial protein that plays a crucial role in various biological processes. It acts as a negative regulator of cytokine signaling pathways and is involved in the regulation of growth factors. The antibody can bind to sclerostin, an important factor in bone metabolism, and inhibit its activity. Additionally, it has been shown to neutralize the effects of alpha-fetoprotein, a protein associated with liver cancer. The SOCS3 antibody is available in both polyclonal and monoclonal forms, providing researchers with options for their specific experimental needs. Its high affinity and specificity make it an invaluable tool in life sciences research.
PGD antibody
The PGD antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to alpha-fetoprotein, a protein that is associated with various diseases and conditions. The PGD antibody has been extensively tested and proven to be highly specific and sensitive in detecting alpha-fetoprotein in human serum samples. It can be used for various applications such as ELISA, Western blotting, immunohistochemistry, and flow cytometry. The PGD antibody can also be conjugated with different markers or enzymes for enhanced detection and visualization. With its high affinity and cytotoxic properties, the PGD antibody holds great potential for targeted therapy in the future.
IL8 antibody
The IL8 antibody is a highly specific antibody used in Life Sciences research. It is available as both polyclonal and monoclonal antibodies. This antibody targets IL8, which is an important chemokine involved in inflammation and immune responses. The IL8 antibody can be used for various applications, including immunohistochemistry, flow cytometry, and ELISA. It has been extensively validated and shows high sensitivity and specificity in detecting IL8 in various samples. The IL8 antibody is produced using advanced techniques to ensure high purity and activity. It is supplied as a buffered solution for easy handling and storage. Whether you are studying autoimmune diseases or investigating the role of IL8 in cancer development, the IL8 antibody is a valuable tool for your research needs.
LIF antibody
The LIF antibody is a polyclonal antibody used in the field of Life Sciences. It specifically targets and inhibits the activity of leukemia inhibitory factor (LIF), which is an important growth factor involved in various cellular processes. This antibody can be used to study the role of LIF in different biological systems, including liver microsomes and hybridoma cells. By blocking the action of LIF, this antibody can potentially have cytotoxic effects on specific cell types, such as cholinergic and catecholaminergic neurons. Additionally, it may be useful for investigating the effects of LIF inhibitors on dopamine signaling pathways. With its high specificity and potency, the LIF antibody is a valuable tool for researchers studying the function and regulation of LIF in various physiological and pathological conditions.
SYN1 antibody
The SYN1 antibody is a highly specialized immunoassay tool used in Life Sciences research. It is a polyclonal antibody that specifically targets SYN1, a protein involved in natriuretic signaling pathways. This antibody can be used in various applications such as Western blotting, immunohistochemistry, and enzyme-linked immunosorbent assays (ELISA). The SYN1 antibody is designed to detect the presence of SYN1 in pharmaceutical preparations and biological samples. It can be used to study the role of SYN1 in different cellular processes, including dopamine release, hypoxia-inducible factor-1 activation, and cytochrome P450 oxidoreductase activity. Researchers can use this antibody to investigate the effects of rapamycin treatment on SYN1 expression and function. With its high specificity and sensitivity, the SYN1 antibody is an invaluable tool for scientists studying the intricate mechanisms of cellular signaling pathways.
Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productDengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%HBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%CA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
