Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75594 products of "Primary Antibodies"
EGFR antibody
The EGFR antibody is a highly specialized monoclonal antibody that targets the epidermal growth factor receptor (EGFR). This receptor plays a crucial role in cell growth and division, making it an important target for cancer treatment. The EGFR antibody works by binding to the EGFR on the surface of cancer cells, blocking its activation and preventing further cell proliferation.
H2AFX antibody
H2AFX antibody was raised using the middle region of H2AFX corresponding to a region with amino acids ELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQE
PNPLA3 antibody
PNPLA3 antibody was raised using the C terminal of PNPLA3 corresponding to a region with amino acids CSPKGCPAETKAEATPRSILRSSLNFFLGNKVPAGAEGLSTFPSFSLEKS
CCL2 antibody
The CCL2 antibody is a monoclonal antibody that specifically targets the chemokine CCL2. This antibody is designed to bind to CCL2, preventing its interaction with its receptor and inhibiting its activity. It can be used in various research applications, including immunoassays, western blotting, and immunohistochemistry.E. coli antibody
E. coli antibody was raised in goat using a mixture of E. coli serotypes as the immunogen.
Purity:Min. 95%Collagen I antibody
The Collagen I antibody is a highly specialized antibody that targets the amino-terminal region of collagen, a crucial protein in the extracellular matrix. This antibody has been extensively studied and proven to be effective in various research applications in Life Sciences.
YARS antibody
YARS antibody was raised using the C terminal of YARS corresponding to a region with amino acids QVEPLDPPAGSAPGEHVFVKGYEKGQPDEELKPKKKVFEKLQADFKISEE
CAV1 antibody
CAV1 antibody was raised using the N terminal of CAV1 corresponding to a region with amino acids SGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDL
TOMM70A antibody
TOMM70A antibody was raised in rabbit using the N terminal of TOMM70A as the immunogen
RAB3D antibody
The RAB3D antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is specifically designed to target and bind to the alpha-fetoprotein (AFP) in human serum. Autoantibodies against AFP have been shown to be associated with various diseases, including liver cancer and hepatocellular carcinoma.
Caspase 8 antibody
Caspase 8 antibody is a highly specific monoclonal antibody that targets caspase 8, an enzyme involved in programmed cell death. This antibody has been extensively tested and validated for its ability to detect and inhibit caspase 8 activity. It can be used in various life science research applications including immunohistochemistry, western blotting, and flow cytometry. The Caspase 8 antibody has been shown to effectively block the activity of caspase 8, making it a valuable tool for studying apoptosis and cell death pathways. Its high specificity ensures accurate and reliable results, making it an essential component in many research projects.
PDF antibody
The PDF antibody is a highly specialized molecule drug used in the field of Life Sciences. It is an activated antibody that acts as an anticoagulant, inhibiting the clotting process. This unique antibody has the ability to neutralize various molecules involved in blood coagulation, such as insulin, albumin, and fibrinogen. The PDF antibody is a monoclonal antibody, meaning it is derived from a single clone of cells and exhibits high specificity for its target. In human serum, this antibody has shown remarkable efficacy in inhibiting protein kinase activity, making it a valuable tool for research and therapeutic applications in the field of Life Sciences.ITGA6 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. This medication is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. It works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication, thus preventing bacterial growth. The remarkable potency of this drug has been demonstrated through various scientific techniques like the patch-clamp technique on human erythrocytes. Additionally, it undergoes several metabolic transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and effectively inhibits their growth in culture
SIX1 antibody
The SIX1 antibody is a polyclonal antibody that specifically targets the SIX1 protein. This antibody is commonly used in research and diagnostic applications to detect the presence of SIX1 in various samples. It can be used in techniques such as immunohistochemistry, Western blotting, and ELISA.
IL3 antibody
The IL3 antibody is a receptor molecule that has neutralizing properties. It is commonly used in hybridization and antibody-related research in the Life Sciences field. This antibody specifically targets interleukin-3 (IL-3), a cytokine that plays a crucial role in the production and differentiation of various blood cells. By binding to IL-3, the IL3 antibody can effectively block its activity, making it an essential tool for studying the function and regulation of IL-3.
PNPase antibody
The PNPase antibody is a highly specialized chemokine antibody that possesses antiviral and anti-mesothelin properties. It is widely used in the field of Life Sciences for various research purposes. This monoclonal antibody specifically targets CD33, a protein expressed on the surface of certain cells, and can be used to study its functions and interactions. The PNPase antibody has also been utilized in electrode development, fibrinogen analysis, growth factor studies, and detection of specific proteins in human serum such as alpha-fetoprotein. Its versatility makes it an invaluable tool for researchers in need of high-quality antibodies and binding proteins. Additionally, this antibody can serve as an inhibitor for specific biological processes when used in appropriate experimental settings.
MPO antibody
The MPO antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to myeloperoxidase (MPO), an enzyme involved in various physiological processes. This antibody has been extensively studied for its role in inflammation, immune response, and cardiovascular diseases.
BMP6 antibody
The BMP6 antibody is a highly specialized collagen-based polyclonal antibody that targets the tyrosine residues in BMP6. This antibody is widely used in life sciences research to study the role of BMP6 in various biological processes. It has been shown to interact with multiple proteins, including plasminogen activator receptor, urokinase plasminogen activator, and alpha-fetoprotein. The BMP6 antibody is available as both a monoclonal and polyclonal antibody, offering researchers flexibility in their experimental design. This antibody has potential therapeutic applications, particularly in the treatment of thrombocytopenia and as a growth factor for tissue repair. Additionally, it has been found to have interactions with hyaluronic acid, further expanding its potential applications in regenerative medicine.
PPP1R13B antibody
PPP1R13B antibody was raised using a synthetic peptide corresponding to a region with amino acids EFDLVQRIIYEVEDPSKPNDEGITPLHNAVCAGHHHIVKFLLDFGVNVNAPurity:Min. 95%MMP8 antibody
The MMP8 antibody is a polyclonal antibody that specifically targets matrix metalloproteinase 8 (MMP8). It is commonly used in research and diagnostic applications to detect and quantify the presence of MMP8 in various samples.
Cytokeratin 10 antibody
Cytokeratin 10 antibody is a highly specialized monoclonal antibody that targets the glycoprotein Cytokeratin 10. It is used for its neutralizing properties in various applications such as immunohistochemistry and Western blotting. This antibody has been extensively tested and validated to ensure its high specificity and sensitivity. It can effectively detect Cytokeratin 10 expression in adipose tissues, human serum, and other biological samples. Additionally, it has been shown to have cytotoxic effects on certain cancer cells when used in combination with active agents like Sn-38. With its exceptional binding affinity and ability to inhibit the activity of Cytokeratin 10, this antibody is a valuable tool for researchers studying autoimmune diseases, cancer biology, and interferon signaling pathways. Whether you are conducting basic research or developing diagnostic assays, this Cytokeratin 10 antibody will provide reliable and accurate results.
NR1H3 antibody
The NR1H3 antibody is a highly specialized monoclonal antibody that targets the chemokine receptor NR1H3. This receptor plays a crucial role in the immune response to viral infections by regulating the activity of serine proteases and other key molecules involved in antiviral defense. The NR1H3 antibody has been extensively studied and proven to be effective in neutralizing the activity of NR1H3, thereby inhibiting viral replication and spread.
CD8a antibody (biotin)
CD8a antibody (biotin) was raised in mouse using trhe alpha chain of chicken CD8 as the immunogen.
Purity:Min. 95%POU2F1 antibody
The POU2F1 antibody is a highly specialized monoclonal antibody that targets the growth factor POU2F1. This antibody has been extensively tested and validated for use in various assays, including those involving human serum and adipose tissue. It specifically recognizes the tyrosine residues of the nuclear POU2F1 protein, allowing for its easy detection and immobilization in experiments.
Dengue NS1 antibody (Subtype 4)
Mouse monoclonal Dengue NS1 antibody (Subtype 4). Supplied in PBS buffer with sodium azide
Desmoglein 2 antibody
Desmoglein 2 antibody is a highly specific monoclonal antibody that is used in various research and diagnostic applications. It is designed to bind to desmoglein 2, a protein that plays a critical role in cell-cell adhesion in epithelial tissues. This antibody can be immobilized on an electrode surface for use in biosensor applications or used in immunohistochemistry and Western blotting techniques.
PSA antibody
The PSA antibody is a highly specialized product in the field of Life Sciences. It belongs to the category of Antibodies and is specifically designed for ultrasensitive detection. This Monoclonal Antibody has undergone surface modification to ensure high specificity and sensitivity in detecting the target protein. It can be used in various applications such as flow immunoassay and electrochemical impedance spectroscopy.
CTBP1 antibody
The CTBP1 antibody is a polyclonal antibody that is used in Life Sciences research. It has a high affinity for the low-density lipoprotein receptor-related protein 1 (LRP1) and can be used to study its role in various cellular processes. The CTBP1 antibody has been shown to inhibit the binding of epidermal growth factor (EGF) to LRP1, suggesting that it may play a role in EGF signaling pathways. Additionally, this antibody has been used to detect autoantibodies against CTBP1 in patients with certain autoimmune diseases. The CTBP1 antibody can be used in various techniques such as immunohistochemistry, western blotting, and ELISA to detect and quantify CTBP1 expression levels. Its specificity and sensitivity make it an ideal tool for researchers studying the function of CTBP1 and its potential as a therapeutic target.
PPP1R3B antibody
PPP1R3B antibody was raised in rabbit using the N terminal of PPP1R3B as the immunogen
Neu antibody
Neu antibody was raised in mouse using tyrosine-phosphorylated synthetic peptide corresponding to amino acids 1242-1255 from the C-terminus of human c-erbB-2 protein. as the immunogen.
DLC1 antibody
DLC1 antibody was raised using the C terminal of DLC1 corresponding to a region with amino acids NLAVCLAPSLFHLNTLKRENSSPRVMQRKQSLGKPDQKDLNENLAATQGL
BACE antibody
The BACE antibody is a monoclonal antibody that has been specifically designed to target and inhibit the activity of beta-secretase (BACE1). This enzyme plays a crucial role in the production of amyloid-beta peptides, which are believed to be key contributors to the development of Alzheimer's disease. By binding to BACE1, the antibody effectively blocks its activity and prevents the formation of amyloid-beta peptides.
MMP10 antibody
The MMP10 antibody is a polyclonal antibody that is used in immunohistochemical studies to detect the presence of matrix metalloproteinase 10 (MMP10) protein. This antibody is widely used in life sciences research to study various cellular processes, including pluripotent stem cell differentiation and hematopoietic development. The MMP10 antibody can be used as a valuable tool for researchers to investigate the expression and localization of MMP10 in different tissues and cell types. It can also be used to inhibit the activity of MMP10 or as a therapeutic reagent in the development of new cytokine inhibitors. With its high specificity and sensitivity, the MMP10 antibody is an essential component for any researcher working in the field of molecular biology and immunology.
EMP2 antibody
EMP2 antibody was raised using the middle region of EMP2 corresponding to a region with amino acids IQLMSCLCVMIAASIYTDRREDIHDKNAKFYPVTREGSYGYSYILAWVAF
STK17A antibody
STK17A antibody was raised in mouse using recombinant Human Serine/Threonine Kinase 17A (Apoptosis-Inducing)
CHKA antibody
CHKA antibody was raised using the middle region of CHKA corresponding to a region with amino acids LESVMFAILAERSLGPKLYGIFPQGRLEQFIPSRRLDTEELSLPDISAEI
beta Tubulin antibody
The beta Tubulin antibody is a highly specialized antibody that targets the beta tubulin protein. This protein plays a crucial role in cell division and is essential for the formation of microtubules, which are involved in various cellular processes. The beta Tubulin antibody has been extensively studied and proven to be effective in detecting and quantifying beta tubulin in various biological samples.
ERBB2 antibody
ERBB2 antibody was raised in Mouse using a purified recombinant fragment of human ERBB2 (aa750-987) expressed in E. coli as the immunogen.
Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productDengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%HBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%CA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
