Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75594 products of "Primary Antibodies"
Human Kappa light chain antibody
The Human Kappa light chain antibody is a monoclonal antibody that specifically targets the kappa light chain of human antibodies. This antibody is widely used in Life Sciences research to study various aspects of human immune response and antibody production.
MVD antibody
The MVD antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that has been developed using cutting-edge technology. This antibody specifically targets and binds to collagen, making it an essential tool for research and diagnostic purposes.
VANGL1 antibody
The VANGL1 antibody is a highly specialized monoclonal antibody that targets the VANGL1 protein. This protein is primarily found in the apical membrane of cells and plays a crucial role in various biological processes. The VANGL1 antibody has been extensively studied in the field of Life Sciences and has shown promising results in research related to epidermal growth factor signaling, tyrosine phosphorylation, human folate transport, collagen synthesis, and anti-CD20 therapy.
Mad2L1 antibody
Mad2L1 antibody is a highly specific monoclonal antibody that targets Mad2L1 protein. Mad2L1 is involved in various cellular processes, including cell cycle regulation and checkpoint control. This antibody can be used for research purposes in the field of Life Sciences to study the role of Mad2L1 in different biological pathways.
IBA1 antibody
The IBA1 antibody is a highly specialized monoclonal antibody that is used in Life Sciences research. It specifically targets and binds to the ionized calcium-binding adapter molecule 1 (IBA1) protein, which is primarily expressed in mouse peritoneal macrophages. This antibody is commonly used for immunohistochemistry and immunofluorescence experiments to visualize and study the activation and behavior of macrophages in various tissues.
EGFR antibody
The EGFR antibody is a highly specialized monoclonal antibody that targets the epidermal growth factor receptor (EGFR). It is designed to inhibit the growth and spread of cancer cells by blocking the interaction between EGFR and its ligands. This antibody has been extensively studied for its potential in treating various types of cancer, including lung, breast, colorectal, and head and neck cancers.
Purity:Min. 95%TNF alpha antibody
TNF alpha antibody was raised in rabbit using highly pure recombinant human TNF-alpha as the immunogen.
Purity:Min. 95%ATXN3 antibody
The ATXN3 antibody is a highly specific monoclonal antibody that targets the ATXN3 antigen. It is commonly used in research and diagnostic applications to detect the presence of autoantibodies against ATXN3. This antibody has been extensively validated for use in immunohistochemistry experiments, allowing researchers to study the distribution and localization of ATXN3 in various tissues and cell types.
PSAT1 antibody
The PSAT1 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to specifically target and bind to the PSAT1 protein, which plays a crucial role in cellular metabolism and growth regulation. This antibody can be used in various applications, including Western blotting, immunohistochemistry, and enzyme-linked immunosorbent assays (ELISA).
PCNA antibody
The PCNA antibody is a highly specific monoclonal antibody that targets the proliferating cell nuclear antigen (PCNA). It is commonly used in research and diagnostic applications to detect and quantify PCNA expression levels. PCNA plays a crucial role in DNA replication and repair, making it an important marker for cell proliferation and DNA synthesis. The PCNA antibody can be used to study various biological processes such as cell cycle progression, tumor growth, and response to DNA damage. With its high specificity and sensitivity, this antibody provides reliable results for researchers in the field of life sciences. Whether you are studying cellular pathways or investigating disease mechanisms, the PCNA antibody is an essential tool for your research.
Goat anti Human IgG Fc
Human IgG Fc antibody was raised in goat using human IgG, Fc fragment as the immunogen.
Mouse Lymphocyte antibody
Mouse Lymphocyte antibody was raised in rabbit using RBC-free murine thymus and spleen cells as the immunogen.
Purity:Min. 95%Fibrinogen antibody
Fibrinogen antibody was raised in sheep using human Fibrinogen purified from plasma as the immunogen.Purity:Min. 95%CD24 antibody (biotin)
CD24 antibody (biotin) was raised in rat using murine heat stable antigen as the immunogen.
Purity:Min. 95%Molecular weight:0 g/molMTUS1 antibody
MTUS1 antibody was raised using the N terminal of MTUS1 corresponding to a region with amino acids QLLACGNTKFEALTVVIQHLLSEREEALKQHKTLSQELVNLRGELVTAST
Amphiphysin antibody
The Amphiphysin antibody is a powerful tool used in the field of Life Sciences. This antibody plays a crucial role in various biological processes, including interferon signaling and fas-mediated apoptosis. It is also involved in the production of autoantibodies, collagen synthesis, glycosylation, and fibroin formation.
C1 inhibitor antibody
The C1 inhibitor antibody is a powerful tool used in Life Sciences research. This antibody specifically targets and binds to the C1 inhibitor protein, which plays a crucial role in regulating the complement system. Autoantibodies against the C1 inhibitor can lead to various autoimmune diseases, making this antibody an essential tool for studying these conditions.
eNOS antibody
The eNOS antibody is a powerful tool used in the field of Life Sciences. It is designed to target and detect endothelial nitric oxide synthase (eNOS), an enzyme involved in the production of nitric oxide. This antibody can be used in various research applications, including immunohistochemistry, Western blotting, and flow cytometry.
SMYD3 antibody
The SMYD3 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to specifically target and bind to the SMYD3 protein, which is primarily found in the nucleus of cells. This immobilized antibody can be used for various applications, including research studies and diagnostic purposes.
PGAM1 antibody
The PGAM1 antibody is a specific antibody that is commonly used in research involving pluripotent stem cells. It plays a crucial role in various assays and experiments related to the field of Life Sciences. This antibody specifically targets and interacts with PGAM1, which is an enzyme involved in the glycolysis pathway. By inhibiting or modulating the activity of PGAM1, researchers can gain insights into its function and potential therapeutic applications.
THC antibody
The THC antibody is a highly specific monoclonal antibody that is used for the detection of delta-9-tetrahydrocannabinol (THC). It is derived from hybridoma cells and has been extensively tested for its accuracy and reliability. The antibody is buffered and can be used with human serum samples.ATF3 antibody
ATF3 antibody was raised in mouse using recombinant Human Activating Transcription Factor 3D-dimer antibody
D-dimer antibody is a monoclonal antibody that specifically targets D-dimer, a protein fragment that is produced when blood clots are broken down. This antibody has antiviral properties and can neutralize the activity of D-dimer, preventing excessive blood clot formation. In addition to its therapeutic use, this antibody is also used in research and diagnostics in the field of Life Sciences. It can be used to study the role of D-dimer in various biological processes, such as wound healing and thrombosis. The formulation of this antibody includes excipients like histidine and insulin to ensure stability and enhance its efficacy.EFNA4 antibody
The EFNA4 antibody is a monoclonal antibody that targets autoantibodies against the EFNA4 protein. This protein is involved in various biological processes, including cell adhesion and migration. The EFNA4 antibody can be used in research and diagnostic applications to detect the presence of autoantibodies in human serum.
Estrogen Receptor antibody
Estrogen Receptor antibody was raised in Mouse using a purified recombinant fragment of ESR1(aa301-595) expressed in E. coli as the immunogen.
CLCA1 antibody
The CLCA1 antibody is a neutralizing monoclonal antibody that is widely used in Life Sciences research. It specifically targets CLCA1, a protein involved in various biological processes including the regulation of epidermal growth factor and hepatocyte growth factor. This antibody has been shown to inhibit the activity of CLCA1 by binding to its target site, preventing its interaction with other proteins or growth factors. In addition, the CLCA1 antibody can be used for immobilization studies or as a tool for detecting CLCA1 dimers in experimental settings. Its high specificity and affinity make it an essential tool for researchers studying the role of CLCA1 in different cellular processes.
TP53 antibody
The TP53 antibody is a glycoprotein that specifically targets the TP53 protein, also known as the tumor protein p53. This antibody is widely used in life sciences research to study the expression and function of TP53. It can be used in various applications such as Western blotting, immunohistochemistry, and immunoprecipitation. The TP53 antibody has been shown to have high specificity and sensitivity in detecting TP53 in nuclear extracts and human serum samples. This monoclonal antibody recognizes both wild-type and mutant forms of TP53, making it a valuable tool for studying the role of TP53 in cancer development and progression. With its superior performance and reliable results, the TP53 antibody is an essential reagent for researchers in the field of molecular biology and oncology.
HS3ST6 antibody
HS3ST6 antibody was raised using a synthetic peptide corresponding to a region with amino acids GERLVSDPAGEVGRVQDFLGLKRVVTDKHFYFNATKGFPCLKKAQGGSRP
Laminin antibody
Laminin antibody was raised in rabbit using laminin isolated from EHS-mouse sarcoma as the immunogen.Purity:Min. 95%Goat anti Human IgM (HRP)
Goat anti-human IgM (HRP) was raised in goat using human IgM mu heavy chain as the immunogen.
Purity:Min. 95%GTDC1 antibody
GTDC1 antibody was raised using the N terminal of GTDC1 corresponding to a region with amino acids CQERDFQYGYNQILSCLVADVVVFNSVFNMESFLTSMGKFMKLIPDHRPK
Lactoferrin antibody
Lactoferrin antibody was raised in Mouse using purified human lactoferrin as the immunogen.FRK antibody
The FRK antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It targets erythropoietin and anti-VEGF, making it an essential tool for studying endothelial growth and antiangiogenic properties. The FRK antibody has been extensively tested and proven to be highly effective in inhibiting the growth factor responsible for angiogenesis. In addition, it has shown cytotoxic effects on cancer cells and has been used to assess microvessel density in tumor samples. This high-quality monoclonal antibody is a valuable asset for researchers and scientists working in the field of antibodies and natriuretic factors. Its colloidal nature ensures easy handling and accurate results, making it an indispensable tool for cutting-edge research in the Life Sciences field.
ZNF319 antibody
ZNF319 antibody was raised in rabbit using the N terminal of ZNF319 as the immunogenPurity:Min. 95%FICD antibody
FICD antibody was raised using the C terminal Of Ficd corresponding to a region with amino acids FAALAHYKLVYIHPFIDGNGRTSRLLMNLILMQAGYPPITIRKEQRSDYY
FAK antibody
The FAK antibody is a powerful tool in the field of Life Sciences. It is an antiviral antibody that specifically targets and neutralizes a cell antigen known as focal adhesion kinase (FAK). FAK is a key regulator of cell growth, migration, and survival, making it an important target for research and therapeutic applications.
MVP antibody
MVP antibody was raised using the N terminal of MVP corresponding to a region with amino acids MATEEFIIRIPPYHYIHVLDQNSNVSRVEVGPKTYIRQDNERVLFAPMRM
SEMA3D antibody
SEMA3D antibody was raised using the middle region of SEMA3D corresponding to a region with amino acids LECIPKSQQATIKWYIQRSGDEHREELKPDERIIKTEYGLLIRSLQKKDS
Purity:Min. 95%KIF5B antibody
KIF5B antibody was raised using the C terminal of KIF5B corresponding to a region with amino acids ANEVKQAVEQQIQSHRETHQKQISSLRDEVEAKAKLITDLQDQNQKMMLE
Purity:Min. 95%Lgi2 antibody
Lgi2 antibody was raised in rabbit using the middle region of Lgi2 as the immunogen
Purity:Min. 95%EMP2 antibody
EMP2 antibody was raised using the middle region of EMP2 corresponding to a region with amino acids IQLMSCLCVMIAASIYTDRREDIHDKNAKFYPVTREGSYGYSYILAWVAF
FGFR2 antibody
The FGFR2 antibody is a specific monoclonal antibody that targets the fibroblast growth factor receptor 2 (FGFR2). It has been extensively studied in the field of life sciences and has shown promising results in various applications. This antibody is highly specific and binds to non-phosphorylated FGFR2, inhibiting its activity.SOX13 antibody
The SOX13 antibody is a highly specialized monoclonal antibody that targets the SOX13 protein. This protein is involved in various cellular processes, including nephrotoxicity, fibrinogen production, and regulation of endogenous hematopoietic stem cells. The SOX13 antibody has been extensively studied in Life Sciences research and has shown promising results in inhibiting the activity of this protein.
Carbamazepine antibody
Carbamazepine antibody is a monoclonal antibody that specifically targets carbamazepine, a commonly used antiepileptic and mood stabilizing drug. This antibody inhibits the binding of carbamazepine to its target receptors, thereby reducing its pharmacological effects. The growth factor fibronectin and endothelial growth factor are known to interact with carbamazepine, and the antibody can effectively block these interactions. Additionally, the antibody has been shown to inhibit the activity of multidrug resistance proteins that are involved in drug efflux. This makes it a valuable tool for studying the mechanisms of drug resistance and developing new strategies to overcome it.BACE antibody
The BACE antibody is a monoclonal antibody that has been specifically designed to target and inhibit the activity of beta-secretase (BACE1). This enzyme plays a crucial role in the production of amyloid-beta peptides, which are believed to be key contributors to the development of Alzheimer's disease. By binding to BACE1, the antibody effectively blocks its activity and prevents the formation of amyloid-beta peptides.
HBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productCA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
