Primary Antibodies

The CD22 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target the CD22 protein, which plays a crucial role in immune response regulation. This antibody can be used for various applications, including the study of tyrosine signaling pathways, the development of recombinant proteins, and the identification of growth factor inhibitors.

Rabbit polyclonal RPL36A antibody

The S100B antibody is a highly specialized product in the field of Life Sciences. It is an antibody derived from human immunoglobulin that specifically targets the growth hormone receptor. This monoclonal antibody has been developed as a chimeric protein, which enhances its efficacy and specificity.

The Lysozyme antibody is a powerful tool in the field of Life Sciences. It is an antibody that specifically targets and detects lysozyme, an enzyme found in various biological systems. This antibody can be used in a wide range of applications, including androgen assays, immunohistochemistry, Western blotting, and ELISA.

DAK antibody was raised in Rabbit using Human DAK as the immunogen

CD97 antibody was raised in Rabbit using Human CD97 as the immunogen

EVL antibody was raised in Rabbit using Human EVL as the immunogen

Rabbit polyclonal Annexin A2 antibody (biotin)

SREBF2 antibody was raised in rabbit using the middle region of SREBF2 as the immunogen

Purified Polyclonal DUSP16 antibody

The MVD antibody is a highly specialized monoclonal antibody that targets the protein MVD (mevalonate diphosphate decarboxylase). This antibody is commonly used in Life Sciences research to study the function and regulation of MVD in various biological processes. It has been shown to interact with interleukin-6, chemokines, and nuclear proteins, indicating its involvement in immune responses and cellular signaling pathways.

EPS15L1 antibody was raised in Rabbit using Human EPS15L1 as the immunogen

Rabbit polyclonal GRM5 antibody

Affinity purified Rabbit polyclonal ENTPD6 antibody

Rabbit polyclonal RPS14 antibody (biotin)

RGS20 antibody was raised using the N terminal of RGS20 corresponding to a region with amino acids KHFSRPSIWTQFLPLFRAQRYNTDIHQITENEGDLRAVPDIKSFPPAQLP

Affinity purified Rabbit polyclonal Integrin alpha 2b antibody

Affinity purified Rabbit polyclonal KLRC4 antibody

CTSL2 antibody was raised in rabbit using the C terminal of CTSL2 as the immunogen

U1SNRNPBP antibody was raised using the N terminal of U1SNRNPBP corresponding to a region with amino acids RAVWRAMLARYVPNKGVIGDPLLTLFVARLNLQTKEDKLKEVFSRYGDIR

Affinity purified Rabbit polyclonal SMAD9 antibody

AGPAT1 antibody was raised in Rabbit using Human AGPAT1 as the immunogen

Affinity purified Rabbit polyclonal SERPINB6 antibody

The Complement factor H antibody is a highly specialized antibody that plays a crucial role in the regulation of the immune system. It binds to glutamate and other molecules to prevent excessive activation of the complement system, which can lead to inflammation and tissue damage. This antibody is widely used in life sciences research, particularly in studies related to insulin, lipoprotein lipase, and heparin-induced thrombocytopenia. It is also used as a diagnostic tool for detecting insulin antibodies and as a therapeutic agent for targeting growth factors such as trastuzumab and epidermal growth factor. With its high specificity and affinity for its target molecules, this monoclonal antibody is an essential component in many medicaments and has proven to be invaluable in various research applications.

Affinity purified Rabbit polyclonal MPI antibody

Rabbit polyclonal DOK7 antibody

The GFAP antibody is a monoclonal antibody that specifically targets the glial fibrillary acidic protein (GFAP). It is widely used in various life sciences applications, including immunoassays and protein detection. This antibody can be used to detect and quantify GFAP levels in various samples, such as human serum or tissue lysates. The GFAP antibody has been shown to inhibit the activity of phosphatase enzymes that are involved in signal transduction pathways. It is also conjugated to magnetic particles, allowing for easy purification and separation of the target molecule. Additionally, this antibody has been found to react with actin filaments, providing valuable insights into cellular structure and function. With its high specificity and sensitivity, the GFAP antibody is an essential tool for researchers studying glial cells and their role in various physiological processes.

The Aromatase antibody is a protein that belongs to the group of Polyclonal Antibodies. It plays a crucial role in the process of glycosylation, which is important for the proper functioning of various biological processes. This antibody can bind to specific targets and help in the detection and analysis of glycoproteins. Additionally, it has been shown to have cholinergic and acetyltransferase activities, making it valuable in research related to neurotransmission and signal transduction. The Aromatase antibody can also be used to detect autoantibodies and phosphatases in biological samples. Furthermore, studies have indicated its involvement in regulating interleukin-6 levels, suggesting its potential role in modulating immune responses. Overall, this monoclonal antibody is an essential tool for researchers in Life Sciences and offers insights into various cellular processes, including genotoxicity and interferon signaling pathways.

C14ORF21 antibody was raised using the middle region of C14Orf21 corresponding to a region with amino acids GGTILESERARPRGSQSSEAQKTPAQECKPADFEVPETFLNRLQDLSSSF

RIPK4 antibody was raised using the N terminal of RIPK4 corresponding to a region with amino acids DGLFGTIAYLPPERIREKSRLFDTKHDVYSFAIVIWGVLTQKKPFADEKN

Rabbit polyclonal PA2G4 antibody

GLRX2 antibody was raised in Rabbit using Human GLRX2 as the immunogen

The CLCA1 antibody is a neutralizing monoclonal antibody that is widely used in Life Sciences research. It specifically targets CLCA1, a protein involved in various biological processes including the regulation of epidermal growth factor and hepatocyte growth factor. This antibody has been shown to inhibit the activity of CLCA1 by binding to its target site, preventing its interaction with other proteins or growth factors. In addition, the CLCA1 antibody can be used for immobilization studies or as a tool for detecting CLCA1 dimers in experimental settings. Its high specificity and affinity make it an essential tool for researchers studying the role of CLCA1 in different cellular processes.

Rabbit polyclonal BLOC1 antibody

Affinity purified Rabbit polyclonal ARHGEF18 antibody

Affinity purified Rabbit polyclonal CRLF1 antibody

Affinity purified Rabbit polyclonal SPR antibody

The eNOS antibody is a powerful tool used in the field of Life Sciences. It is designed to target and detect endothelial nitric oxide synthase (eNOS), an enzyme involved in the production of nitric oxide. This antibody can be used in various research applications, including immunohistochemistry, Western blotting, and flow cytometry.

Rabbit polyclonal SYN1 antibody (Ser549)

Rabbit polyclonal CIB3 antibody

The FGF9 antibody is a highly effective monoclonal antibody that targets the acidic protein caspase-9. It has potent antiviral properties and has been shown to inhibit the activity of p38 MAPK, a key enzyme involved in cellular signaling pathways. This antibody specifically binds to nuclear factor kappa-light-chain-enhancer and β-catenin, preventing their activation and subsequent gene expression. Additionally, it has been found to have endonuclease activity, which can lead to DNA fragmentation and cell death in targeted cells. The FGF9 antibody is widely used in life sciences research, particularly in studies involving Mycoplasma genitalium. It is available as both monoclonal and polyclonal antibodies, providing researchers with options for their specific experimental needs. With its ability to inhibit polymerase activity and modulate p38 mitogen-activated protein signaling, this antibody offers great potential for various applications in the field of protein research.

The COX2 antibody is a polyclonal antibody that is widely used in the field of Life Sciences. It specifically targets the cyclooxygenase-2 enzyme (COX2), which plays a crucial role in inflammation and pain. This antibody has been extensively studied and validated for its high specificity and sensitivity in detecting COX2 expression.

The CHAT antibody is a highly specialized monoclonal antibody that targets the cholinergic growth factor, choline acetyltransferase (CHAT). It plays a crucial role in the synthesis of acetylcholine, a neurotransmitter involved in various physiological processes. This antibody has been extensively studied for its ability to neutralize virus surface antigens and exhibit cytotoxic effects on cells expressing CHAT.

ENTPD4 antibody was raised in Rabbit using Human ENTPD4 as the immunogen

MYEF2 antibody was raised in Rabbit using Human MYEF2 as the immunogen

NR0B1 antibody was raised using the N terminal of NR0B1 corresponding to a region with amino acids  TSSKQTHVAPAAPEARPGGAWWDRSYFAQRPGGKEALPGGRATALLYRCC

The XRCC4 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the XRCC4 protein, which plays a crucial role in DNA repair and recombination. The antibody binds to the histidine-tagged XRCC4 protein, allowing for its detection and analysis in various experimental settings. This XRCC4 antibody is commonly used in studies involving pluripotent cells, collagen synthesis, lipoprotein lipase regulation, and immune response modulation. Additionally, it has been shown to interact with other proteins such as interferon, TGF-beta, and endothelial growth factors. The XRCC4 antibody offers researchers a valuable tool for investigating DNA repair mechanisms and understanding their implications in various biological processes.

Rabbit polyclonal Prostacyclin Receptor antibody

LGALS14 antibody was raised using the N terminal of LGALS14 corresponding to a region with amino acids MSSLPVPYTLPVSLPVGSCVIITGTPILTFVKDPQLEVNFYTGMDEDSDI

The Histone H2Ax antibody is a highly specialized monoclonal antibody used in Life Sciences research. This antibody specifically targets and binds to the acidic histone protein H2Ax, which plays a crucial role in DNA repair and damage response. By detecting the presence of H2Ax, researchers can gain valuable insights into various cellular processes, including fibrinogen activation, growth factor signaling, and multidrug resistance.

Rabbit polyclonal LATH antibody

Purified Polyclonal ENT1 antibody

Thyroid Peroxidase antibody is a monoclonal antibody used in Life Sciences research. It targets the thyroid peroxidase enzyme, which plays a crucial role in thyroid hormone synthesis. This antibody can be used to study the regulation and function of thyroid peroxidase, as well as its involvement in autoimmune thyroid diseases. Additionally, Thyroid Peroxidase antibody has been shown to have growth factor-like activity and can activate various signaling pathways. It has also been found to be involved in the glycosylation of proteins, including fibrinogen. Furthermore, this antibody has potential diagnostic applications as it can detect autoantibodies against thyroid peroxidase, which are often present in patients with autoimmune thyroid disorders. Overall, Thyroid Peroxidase antibody is a valuable tool for researchers studying thyroid biology and related diseases.

Affinity purified Rabbit polyclonal FASTKD1 antibody

Rabbit polyclonal CRGF antibody

GATM antibody was raised in Rabbit using Human GATM as the immunogen

Affinity purified Rabbit polyclonal TRADD antibody

The GPR120 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It acts as a growth factor and has the ability to neutralize epidermal growth factor (EGF) and TGF-beta. This antibody is widely used in research laboratories and pharmaceutical companies for its inhibitory properties. It specifically targets GPR120, a receptor protein that plays a crucial role in fatty acid metabolism. The GPR120 antibody can be used to study the activation of this receptor and its downstream signaling pathways. Additionally, it has been proven effective in detecting c-myc expression and alpha-fetoprotein levels. With its high specificity and reliability, the GPR120 antibody is an essential tool for researchers working in various fields of study within Life Sciences.

Rabbit polyclonal Kininogen 1 antibody

Rabbit polyclonal AKAP14 antibody

The p53 antibody is a highly effective inhibitor used in Life Sciences research. This monoclonal antibody specifically targets and neutralizes the p53 protein, which plays a crucial role in regulating cell growth and preventing tumor formation. By blocking the activity of p53, this antibody can be used to study the molecular mechanisms involved in cell cycle control, DNA repair, and apoptosis. Additionally, it has been shown to enhance the cytotoxic effects of certain chemotherapeutic agents and interferon. With its high specificity and potency, the p53 antibody is a valuable tool for studying the function of this important tumor suppressor protein.

Rabbit polyclonal OR52A4 antibody

DHRS4 antibody was raised in Rabbit using Human DHRS4 as the immunogen

Rabbit polyclonal p44 MAPK antibody

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, thereby inhibiting bacterial growth and preventing transcription and replication. In addition, it has been extensively studied using advanced techniques like patch-clamp technique on human erythrocytes. The metabolism of this drug involves various transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Furthermore, it specifically targets markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture.

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a potent antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth by preventing transcription and replication. This drug has been extensively studied using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. It undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, or conjugation. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth. Experience the powerful action of 6-Fluoro-3-indoxyl-beta-D-galactopyranoside for effective tuberculosis treatment.

Mouse monoclonal HIV1 p55+17 antibody

The Histamine H4 Receptor antibody is a powerful tool for researchers in the field of Life Sciences. It is available in both polyclonal and monoclonal forms, providing options for different experimental needs.

The SCG3 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the nuclear factor kappa-light-chain-enhancer of activated B cells (NF-κB), which is a transcription factor involved in various cellular processes. The SCG3 antibody has been shown to inhibit the polymerase activity of NF-κB, leading to a decrease in gene expression of acidic proteins. This antibody can be used in immunoassays to detect and quantify NF-κB activation. Additionally, the SCG3 antibody has proteolytic activity and has been shown to cleave caspase-9, an endonuclease involved in apoptosis. Its immobilization on surfaces allows for easy and efficient use in various experimental settings, making it a valuable tool for researchers studying NF-κB signaling pathways and related cellular processes.

H2AFY2 antibody was raised in Rabbit using Human H2AFY2 as the immunogen

IGF1R antibody was raised in rabbit using the middle region of IGF1R as the immunogen

BCL2L1 antibody was raised in rabbit using the N terminal of BCL2L1 as the immunogen

Rabbit polyclonal PARK2 antibody (Ser101)

LASP1 antibody was raised in Rabbit using Human LASP1 as the immunogen

GRAP2 antibody was raised in Rabbit using Human GRAP2 as the immunogen

Affinity purified Rabbit polyclonal PDE6D antibody

PARP11 antibody was raised using a synthetic peptide corresponding to a region with amino acids SAFSYICENEAIPMPPHWENVNTQVPYQLIPLHNQTHEYNEVANLFGKTM

Rabbit polyclonal Stathmin 1 antibody (Ser37)

Affinity purified Rabbit polyclonal Cartilage associated protein antibody

Rabbit polyclonal GPR103 antibody

The ZHX2 antibody is a protein reagent used in Life Sciences research. It is a polyclonal antibody that specifically targets and inhibits cytokines. This antibody is widely used in various experiments and studies to investigate the role of cytokines in different biological processes. With its high specificity and potency, the ZHX2 antibody is an essential tool for researchers in the field of immunology and molecular biology. Whether you are studying immune responses, inflammation, or cell signaling pathways, this antibody can provide valuable insights into the mechanisms underlying these processes. Trust the ZHX2 antibody to deliver reliable results and contribute to advancements in scientific knowledge.

Affinity purified Rabbit polyclonal DUSP8 antibody

Affinity purified Rabbit polyclonal PEF1 antibody

The SOCS3 antibody is a biomaterial protein that plays a crucial role in various biological processes. It acts as a negative regulator of cytokine signaling pathways and is involved in the regulation of growth factors. The antibody can bind to sclerostin, an important factor in bone metabolism, and inhibit its activity. Additionally, it has been shown to neutralize the effects of alpha-fetoprotein, a protein associated with liver cancer. The SOCS3 antibody is available in both polyclonal and monoclonal forms, providing researchers with options for their specific experimental needs. Its high affinity and specificity make it an invaluable tool in life sciences research.

EBAG9 antibody was raised in Rabbit using Human EBAG9 as the immunogen

The PGD antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to alpha-fetoprotein, a protein that is associated with various diseases and conditions. The PGD antibody has been extensively tested and proven to be highly specific and sensitive in detecting alpha-fetoprotein in human serum samples. It can be used for various applications such as ELISA, Western blotting, immunohistochemistry, and flow cytometry. The PGD antibody can also be conjugated with different markers or enzymes for enhanced detection and visualization. With its high affinity and cytotoxic properties, the PGD antibody holds great potential for targeted therapy in the future.

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.