Primary Antibodies

<p>Procalcitonin antibody is a monoclonal antibody that targets procalcitonin, a protein that is involved in various biological processes. This antibody is widely used in Life Sciences research to study the role of procalcitonin in endothelial growth, alpha-fetoprotein regulation, and other physiological functions. The high specificity and affinity of this monoclonal antibody make it an excellent tool for detecting and quantifying procalcitonin levels in various samples. It can be used in techniques such as immunohistochemistry, enzyme-linked immunosorbent assay (ELISA), Western blotting, and flow cytometry. Additionally, this antibody can be conjugated with different labels or enzymes for easy detection and visualization. Whether you are studying procalcitonin's involvement in cancer, inflammation, or other diseases, this highly reliable and versatile antibody will provide accurate and reproducible results.</p>

<p>Anti-Canine Heartworm antibody</p>

<p>PGS1 antibody was raised using the C terminal of PGS1 corresponding to a region with amino acids QIAIVTENQALQQQLHQEQEQLYLRSGVVSSATFEQPSRQVKLWVKMVTP</p>

<p>FSH antibody is a monoclonal antibody that specifically targets follicle-stimulating hormone (FSH). It binds to FSH and inhibits its activity, which plays a crucial role in the regulation of the reproductive system. This antibody has been extensively used in immunoassays to detect and quantify FSH levels in human serum. Additionally, FSH antibody has shown potential therapeutic applications in various conditions such as cancer and autoimmune diseases. Its cytotoxic properties make it an effective tool for targeted therapy against FSH receptor-expressing cells. Furthermore, FSH antibody has been studied for its role in melanogenesis, as it inhibits tyrosinase activity and reduces the production of melanin.</p>

<p>FSH beta antibody was raised in mouse using human FSH beta as the immunogen.</p>

<p>Gram negative endotoxin antibody was raised in mouse using E. coli O:111 B4 J5 cells as the immunogen.</p>

<p>E. coli antibody (biotin) was raised in rabbit using mixtures of all antigenic serotypes as the immunogen.</p>

<p>The MUC2 antibody is a highly specialized product in the field of Life Sciences. It belongs to the category of monoclonal antibodies, which are widely used in various research and diagnostic applications. This particular antibody targets the MUC2 protein, which is involved in the regulation of mucin production. The MUC2 antibody acts as a potent inhibitor of CYP2A6, an enzyme responsible for the metabolism of certain drugs and toxins in the body. By inhibiting this enzyme, the antibody can enhance the effectiveness of medications that are metabolized by CYP2A6. In addition to its role as a protein inhibitor, the MUC2 antibody has been shown to have other therapeutic properties. It has been found to reduce microvessel density, which is important in limiting tumor growth and metastasis. The antibody also modulates the activity of growth factors and globulins, further contributing to its potential as a medicament. Furthermore, studies have demonstrated that the MUC2 antibody can</p>

<p>CD31 antibody was raised in mouse using prokaryortic recombinant fusion of protein corresponding to a portion of the extracelluar domain downstream of the signal sequence of the CD31 molecule as the immunogen.</p>

<p>The Testosterone antibody is a powerful tool for researchers and scientists working in the field of endocrinology. This monoclonal antibody specifically targets testosterone, a hormone that plays a crucial role in various physiological processes. The Testosterone antibody has been extensively tested and validated for its specificity and sensitivity. It binds to testosterone with high affinity, allowing for accurate detection and quantification of this hormone in biological samples. One of the key applications of the Testosterone antibody is its use in immunoassays, such as ELISA or Western blotting. By utilizing this antibody, researchers can measure testosterone levels in serum, plasma, or tissue extracts with great precision. Additionally, the Testosterone antibody can be used for immunohistochemistry (IHC) to visualize the localization of testosterone within tissues. This technique provides valuable insights into the distribution and expression patterns of testosterone in various organs and cell types. Moreover, this antibody has been shown to have minimal cross-reactivity with other related hormones or compounds, ensuring accurate</p>

<p>IRF3 antibody was raised in mouse using recombinant Interferon Regulatory Factor 3</p>

<p>The Influenza B Antibody is a highly effective neutralizing antibody that targets the influenza hemagglutinin protein. It has been extensively tested and proven to be activated against various strains of the influenza virus. This antibody has shown exceptional binding affinity and specificity, making it an ideal candidate for diagnostic and therapeutic applications.</p>

<p>Vinculin purified from human platelet plasma membrane</p>

<p>Mouse monoclonal Heat Stable Enterotoxin antibody</p>

<p>ApoA-I antibody was raised in mouse using human Apo A-I as the immunogen.</p>

<p>The Testosterone Antibody is a highly specialized product used in Life Sciences research. It is a monoclonal antibody that specifically binds to testosterone, a steroid hormone involved in various physiological processes. This antibody is designed to target the testosterone molecule and can be used for applications such as immunoassays and protein complex analysis.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycins class. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth, preventing transcription and replication. This drug has been extensively studied and proven to be active using the patch-clamp technique on human erythrocytes. Metabolized through various transformations, including hydrolysis, oxidation, reduction, and conjugation, it specifically targets Mycobacterium tuberculosis strains and inhibits cell growth. Trust this drug for its effectiveness in combating tuberculosis infections.</p>

<p>Calcitonin antibody was raised in mouse using calcitonin conjugated with carrier protein as the immunogen.</p>

<p>Mouse monoclonal E. coli antibody (K99 Pilus)</p>

<p>Fibrinogen antibody was raised in mouse using fibrin degradation products as the immunogen.</p>