Primary Antibodies

<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>

<p>FGF9 antibody was raised in rabbit using highly pure recombinant murine FGF-9 as the immunogen.</p>

<p>Cu/Zn SOD antibody was raised in rabbit using native human Cu/Zn SOD-1. as the immunogen.</p>

<p>Human IgM antibody (mu chain) was raised in goat using human IgM Mu chain as the immunogen.</p>

<p>Prohibitin antibody (biotin) was raised in mouse using purified recombinant rat prohibitin protein as the immunogen.</p>

<p>Cathepsin D antibody was raised in rabbit using purified cathepsin D (liver) as the immunogen.</p>

<p>PCNA antibody (biotin) was raised in mouse using recombinant rat proliferating cell nuclear antigen protein as the immunogen.</p>

<p>Chlamydia Pneumoniae Elementary and Reticular Bodies Antigen is an antibody for use in pharmaceutical and diagnostic applications. Please enquire for more information about Chlamydia Pneumoniae Elementary and Reticular Bodies Antigen including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Glutathione peroxidase antibody was raised in sheep using human glutathione peroxidase from Erythrocytes as the immunogen.</p>

<p>Human serum albumin antibody was raised in goat using normal human serum albumin as the immunogen.</p>

<p>CHRNA4 antibody was raised using the N terminal of CHRNA4 corresponding to a region with amino acids AEERLLKKLFSGYNKWSRPVANISDVVLVRFGLSIAQLIDVDEKNQMMTT</p>

<p>Chlamydia trachomatis antibody is a test substance used in the field of Life Sciences to detect the presence of Chlamydia trachomatis, a bacterium that causes various sexually transmitted infections. This monoclonal antibody specifically targets and binds to antigens expressed by Chlamydia trachomatis, allowing for the immobilization and detection of the bacteria during hybridization experiments or diagnostic tests. The antibody has been extensively validated for its specificity and sensitivity, making it a reliable tool in both research and industrial settings. Additionally, it exhibits antioxidant activity, which may have potential therapeutic applications. Whether you're conducting cutting-edge research or running routine diagnostics, this monoclonal antibody is an essential tool for accurate detection and analysis.</p>

<p>Extracellular signal-regulated kinase 1/2 (ERK1/2) is a mitogen-activated protein kinase (MAPK) family protein and part of the Ras-Raf-MEK-ERK signalling pathway which plays a key role in controlling cell proliferation, differentiation and cell survival. ERK1/2 acts downstream of activated growth factor receptors, RAF protein kinases and mitogen-activated protein kinase kinases 1 and 2 (MEK1/2). MEK1 and MEK2 activate ERK1/2 by phosphorylation and once activated ERK1/2 enters the nucleus and phosphorylates transcription factors to induce changes in gene expression. In addition to this active ERK1/2 also translocates to other organelles including the endoplasmic reticulum, endosomes, golgi and mitochondria where it influences cell physiology. Overall ERK1/2 phosphorylates more than 200 different substrates including other protein kinases, transcription factors, RNA-binding proteins, regulators of mRNA translation and regulators of cell death. ERK1/2 pathway is strongly implicated in cancer where its hyperactivation underpins the growth and maintenance of many tumour types._x000D_<br>_x000D_<br>This antibody is conjugated to Alexa Fluor® 488. Alexa Fluor® 488 is a popular bright green fluorescent dye with high pH-stability.</p>

<p>Lysozyme antibody was raised in rabbit using full length protein corresponding to amino acids 1-129 of Hen Egg White lysozyme as the immunogen.</p>

<p>Anti-Human IL-6R Monoclonal Antibody</p>

<p>Anti-GD2 monoclonal antibody</p>

<p>Apo-A1 Goat Polyclonal Antibody is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Apo-A1 Goat Polyclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>A fully human IgG1 agonistic monoclonal antibody that targets tumor necrosis factor-related apoptosis-inducing ligand receptor 1 (TRAIL-R1).</p>

<p>The Hepatitis C Virus antibody is a cholinergic antibody used in the field of Life Sciences. It is an androgen that targets specific antigens and growth factors associated with the Hepatitis C Virus. This Monoclonal Antibody works by inhibiting the activity of choline acetyltransferase, an enzyme involved in the synthesis of acetylcholine. By targeting this enzyme, the antibody disrupts the normal functioning of the virus and prevents its replication. Additionally, this antibody has been shown to exhibit cytotoxic effects on infected cells, making it a promising tool for diagnostic assays and potential therapeutic applications. With its high specificity and efficacy, this monoclonal antibody is a valuable asset in Hepatitis C research and treatment.</p>

<p>CA 50 antibody was raised in mouse using human CA50 antigen as the immunogen.</p>