Primary Antibodies

<p>Human growth hormone antibody was raised in mouse using recombinant human growth hormone as the immunogen.</p>

<p>The IL6 monoclonal antibody is a powerful tool in the field of Life Sciences. This antibody specifically targets and binds to interleukin-6 (IL6), a protein involved in various biological processes such as inflammation and immune response. By blocking the interaction between IL6 and its receptors, this monoclonal antibody can modulate the activity of IL6, leading to potential therapeutic benefits.</p>

<p>Methamphetamine antibody was raised in mouse using methamphetamine-4-BSA as the immunogen.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is known to be highly effective in treating tuberculosis infections, thanks to its bactericidal activity. This compound works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its potency has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>Insulin beta chain antibody was raised in mouse using C-terminal pentapeptide of insulin b-chain as the immunogen.</p>

<p>Goat polyclonal cholera toxin antibody (B subunit)</p>

<p>IL6 antibody was raised in mouse using recombinant human IL6 as the immunogen.</p>

<p>The ApoB antibody is a monoclonal antibody that targets apolipoprotein B, a protein involved in lipid metabolism. It has been shown to have inhibitory effects on the formation of antiphospholipid antibodies, which are associated with autoimmune disorders. Additionally, this antibody has been found to modulate the expression of chemokines and alpha-fetoprotein, suggesting potential therapeutic applications in inflammation and cancer. Polyclonal antibodies against ApoB have also demonstrated the ability to inhibit factors involved in interferon and colony-stimulating factor signaling pathways. In research studies, this antibody has shown efficacy in inducing lysis of MCF-7 breast cancer cells and enhancing the expression of E-cadherin, a protein involved in cell adhesion. The ApoB antibody is widely used in life sciences research and is formulated with high-quality excipients for optimal stability and performance.</p>

<p>Ferritin antibody was raised in mouse using human ferritin as the immunogen.</p>

<p>S100 antibody was raised in mouse using purified bovine brain S100 protein as the immunogen.</p>

<p>CHRNG antibody was raised in rabbit using the N terminal of CHRNG as the immunogen</p>

<p>Eosinophil major basic protein antibody was raised in mouse using human eosinophil major basic protein as the immunogen.</p>

<p>Influenza A antibody was raised in mouse using Influenza A as the immunogen.</p>

<p>ABCB4 antibody was raised using a synthetic peptide corresponding to a region with amino acids GRTCIVIAHRLSTIQNADLIVVFQNGRVKEHGTHQQLLAQKGIYFSMVSV</p>

<p>FSH antibody is a monoclonal antibody that specifically targets follicle-stimulating hormone (FSH). It is widely used in life sciences research to study the role of FSH in various biological processes. This antibody binds to FSH and inhibits its activity, allowing researchers to investigate the effects of FSH on cell growth, hormone production, and reproductive functions. Additionally, FSH antibody has been shown to have potential therapeutic applications in the treatment of certain diseases, such as hormone-related cancers. Its high specificity and affinity make it a valuable tool for scientists studying FSH and its interactions with other molecules in the body.</p>

<p>Purified Polyclonal ADRB2 antibody</p>

<p>Sheep polyclonal DHEA Sulphate antibody</p>

<p>The proBNP antibody is a highly specific monoclonal antibody that targets proBNP, a precursor of the B-type natriuretic peptide. This antibody has cytotoxic effects on cells that overexpress proBNP, inhibiting their growth and proliferation. It also blocks the activity of growth factors such as collagen and TGF-beta, which are involved in cell signaling pathways. The proBNP antibody can be used in various applications in the life sciences field, including hybridization studies, immunohistochemistry, and flow cytometry. It is also being investigated as a potential therapeutic agent for multidrug-resistant bacteria due to its antibiotic properties. When used in combination with ethionamide, it has shown promising results in inhibiting bacterial growth. With its high affinity for the amino-terminal region of proBNP, this antibody offers great potential for research and diagnostic purposes in the field of cardiology and cardiovascular diseases.</p>

<p>Mouse monoclonal DO11.10 TCR antibody (biotin)</p>

<p>GLUT1 antibody was raised in rabbit using a 12 amino acid peptide of mouse GT11 as the immunogen.</p>