Primary Antibodies

<p>Hemoglobin A1c antibody was raised in sheep using human hemoglobin A1c as the immunogen.</p>

<p>Sheep polyclonal Zearalanone antibody</p>

<p>PSA antibody is a monoclonal antibody that specifically targets prostate-specific antigen (PSA). It is commonly used in the field of Life Sciences for various applications, including research and diagnostic purposes. This antibody recognizes and binds to PSA, a chemokine enzyme that is primarily produced by the prostate gland. The binding of the PSA antibody to its target can be used to detect and measure PSA levels in biological samples, such as blood or tissue. Additionally, this antibody has been shown to have neutralizing properties, inhibiting the enzymatic activity of PSA. With its high specificity and sensitivity, the PSA antibody is an essential tool for studying prostate-related diseases and developing new therapeutic strategies.</p>

<p>The Complement C3 antibody is a powerful tool in immunology research. This monoclonal antibody is specifically designed to target and neutralize the complement component C3, a key protein involved in the immune response. By binding to C3, this antibody prevents its lysis activity and inhibits its function in the complement cascade. In addition to its neutralizing properties, this antibody has been shown to have other therapeutic applications. It has been used in combination with other antibodies, such as trastuzumab, to enhance their efficacy in targeting cancer cells that overexpress epidermal growth factor receptors. Furthermore, it has been found to enhance the activity of interferons, which are important mediators of the immune response against viral infections. The Complement C3 antibody can be used in various experimental techniques, including immunoprecipitation, Western blotting, and flow cytometry. Its specificity and high affinity make it an ideal tool for studying the role of C3 in different biological processes.</p>

<p>Sheep anti bovine IgA was raised in sheep using bovine IgA as the immunogen.</p>

<p>Transferrin antibody is an essential tool used in life sciences research. It plays a crucial role in various applications, including immunoassays, immunohistochemistry, and western blotting. This antibody specifically targets transferrin, a protein involved in iron transport within the body. By binding to transferrin, this antibody allows for the detection and quantification of transferrin levels in samples.</p>

<p>Alpha-1 acid glycoprotein antibody was raised in goat using human alpha-1 acid glycoprotein as the immunogen.</p>

<p>PCP antibody is a glycosylated protein that plays a crucial role in various biological processes. It is commonly used in Life Sciences research as a tool to study the function of the PCP pathway. This pathway is involved in cell polarity and tissue development.</p>

<p>Metabotropic glutamate receptors (mGluRs) are G protein-coupled receptors that have been divided into three groups based on sequence, putative signal transduction mechanisms, and pharmacologic properties. mGluR1 is a group I receptor. Group I mGluRs are predominantly expressed in the postsynaptic somatodendritic regions, especially in brain areas highly responsive to psychostimulants. mGluR1 is a pivotal regulator of glutamatergic neurotransmission which is involved in most aspects of normal brain function and can be perturbed in many neuropathologic conditions._x000D_<br>_x000D_<br>Group I mGluRs are coupled exclusively to Gq protein (Gq/11), a heterotrimeric G protein subunit that activates phospholipase C (PLC) and regulates inositol 1,4,5-tris phosphate (IP3) receptors via association with the synaptic scaffolding protein, Homer._x000D_<br>_x000D_<br>mGluRs modulate neuronal excitability and development, synaptic plasticity and neurotransmitter release underlying optimal cognitive function. Activation of mGluR1 facilitates long-term depression of parallel fiber-Purkinje cell synapses critical for cerebellar motor learning._x000D_<br>_x000D_<br>This antibody is conjugated to Alexa Fluor® 488, a popular bright green fluorescent dye with high pH-stability.</p>

<p>Anti-Human IgM is a monoclonal antibody used in the field of Life Sciences. It specifically targets and inhibits the action of IgM antibodies in humans. This antibody has been extensively studied for its potential as an inhibitor of growth factors, particularly those involved in tyrosine signaling pathways. It has shown promising results in blocking the activity of c-myc, a protein associated with cell proliferation and cancer development. Additionally, Anti-Human IgM has been investigated as a potential therapeutic agent against HER2-positive breast cancer. Studies have demonstrated its ability to bind to the HER2 receptor and inhibit its function, making it a valuable tool for targeted therapy. Furthermore, Anti-Human IgM has also been explored for its potential role in treating neurodegenerative diseases such as Parkinson's disease, as it has shown efficacy in reducing the accumulation of alpha-synuclein protein aggregates. Overall, this monoclonal antibody holds great promise for various applications in the field of Life Sciences and is an</p>

<p>Chlamydia trachomatis antibody is a specific antibody that inhibits the growth of Chlamydia trachomatis, a bacterium that causes various sexually transmitted infections. This antibody specifically targets the epidermal growth factor receptor on the surface of infected cells, preventing the bacteria from attaching and entering the host cells. It has been shown to effectively neutralize Chlamydia trachomatis in laboratory studies.</p>

<p>IFN beta antibody was raised in goat using human interferon beta as the immunogen.</p>

<p>GFPT2 antibody was raised using the middle region of GFPT2 corresponding to a region with amino acids TARQGRPIILCSKDDTESSKFAYKTIELPHTVDCLQGILSVIPLQLLSFH</p>

<p>LYN antibody was raised in sheep using maltose binding protein fusion protein as the immunogen.</p>

<p>Purified COVID-19 Nucleoprotein Antibody</p>

<p>The ACTA2 antibody is a highly effective and versatile tool in the field of Life Sciences. This colloidal antibody is specifically designed to target and bind to the HER2 protein, which plays a crucial role in various cellular processes. By binding to HER2, the ACTA2 antibody disrupts the formation of actin filaments, leading to impaired cell growth and proliferation.</p>

<p>Anti-Ptgdr2 antibody</p>

<p>Rabbit polyclonal FGF2 antibody (biotin)</p>

<p>Myoglobin antibody was raised in goat using human heart myoglobin as the immunogen.</p>

<p>ApoA-I antibody was raised in goat using affinity purified human apolipoprotein A-I as the immunogen.</p>