Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Show 1 more subcategories
Found 75594 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Cathepsin B antibody
Cathepsin B antibody was raised in rabbit using cathepsin B (human Liver) as the immunogen.Purity:Min. 95%ALAS1 antibody
ALAS1 antibody was raised using the N terminal of ALAS1 corresponding to a region with amino acids ETSAGPSVVSVKTDGGDPSGLLKNFQDIMQKQRPERVSHLLQDNLPKSVS
PPIL2 antibody
PPIL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MKIIDPDEEKAKQDPSYYLKNTNAETRETLQELYKEFKGDEILAATMKAP
TSH antibody
TSH antibody was raised in goat using human TSH whole molecule as the immunogen.
Purity:Min. 95%Goat anti Human IgA (alpha chain)
Goat anti-Human IgA (alpha chain) was raised in goat using purified Human IgA as the immunogen.
Purity:Min. 95%Human IgM antibody
The Human IgM antibody is a monoclonal antibody that plays a crucial role in the immune system. It is responsible for neutralizing pathogens and activating other immune cells to fight against infections. This antibody has been shown to have potent antiviral activity, particularly against viruses like influenza and HIV. Additionally, it has been found to inhibit the growth of cancer cells by targeting specific receptors involved in cell proliferation. The Human IgM antibody also possesses nephrotoxic properties, which can be utilized in certain therapeutic applications. Furthermore, this antibody has been studied for its potential as a diagnostic tool for autoimmune diseases, as it can detect the presence of autoantibodies in patient samples. Overall, the Human IgM antibody is a versatile and powerful tool in immunology research and clinical applications.Neisseria Gonorrhoeae Antibody
Neisseria Gonorrhoeae Antibody is a monoclonal antibody known as trastuzumab that specifically targets Neisseria gonorrhoeae, the bacteria responsible for causing gonorrhea. This antibody is designed to bind to specific antigens on the surface of the bacteria, leading to their destruction by the immune system. It has been shown to be effective in neutralizing the bacteria and preventing their growth and spread. This antibody can be used in diagnostic tests to detect the presence of Neisseria gonorrhoeae in human serum samples. Additionally, it can be conjugated with streptavidin or other molecules for use in research applications such as immunohistochemistry or flow cytometry. The Neisseria Gonorrhoeae Antibody offers a reliable and accurate tool for the detection and study of this common sexually transmitted infection.Human Growth Hormone antibody
The Human Growth Hormone antibody is a glycosylated protein that plays a crucial role in endothelial growth and development. It acts as a growth factor and interacts with androgen receptors to regulate various physiological processes. The antibody specifically targets the human growth hormone, inhibiting its activity and preventing excessive growth.ApoB antibody
ApoB antibody was raised in mouse using human low density lipoprotein as the immunogen.
UCP3 antibody
UCP3 antibody was raised in rabbit using a 14 amino acid peptide of human UCP3 as the immunogen.
Purity:Min. 95%Cardiac Troponin T (cTnT) Mouse Monoclonal Antibody, Recombinant
Cardiac Troponin T (cTnT) Mouse Monoclonal Antibody, Recombinant
