Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75512 products of "Primary Antibodies"
CD147 antibody
The CD147 antibody is a versatile and potent steroid that has antidiabetic properties. It acts by inhibiting the activity of phosphatase, which plays a crucial role in regulating blood glucose levels. Additionally, this antibody can modulate chemokine activity, making it an effective tool for studying immune responses.
TRSPAP1 antibody
TRSPAP1 antibody was raised using the middle region of TRSPAP1 corresponding to a region with amino acids KPVEYSQMYSYSYNQYYQQYQNYYAQWGYDQNTGSYSYSYPQYGYTQSTM
Tetanus toxin antibody
Tetanus toxin antibody is a monoclonal antibody that acts as an inhibitor of the tetanus toxin. It belongs to the class of antibodies known as neutralizing antibodies, which are active agents in the field of life sciences. This monoclonal antibody specifically targets and neutralizes the effects of tetanus toxin by binding to it and preventing it from causing harm. Additionally, this antibody has been shown to have potential therapeutic applications in other areas, such as inhibiting the activity of epidermal growth factor (EGF) and atypical hemolytic autoantibodies. With its versatility and efficacy, this monoclonal antibody offers promising possibilities for medical research and treatment options.
Purity:>92% By Gel Electrophoresis And Gel ScanningCDH3 antibody
The CDH3 antibody is a highly specialized monoclonal antibody that targets the CDH3 protein. It is produced by hybridoma cells and has been extensively studied in the field of Life Sciences. This antibody plays a crucial role in regulating cell growth and signaling pathways.
PTGER1 antibody
The PTGER1 antibody is a highly specialized polyclonal antibody that is designed to specifically target and bind to the PTGER1 antigen. This antibody is widely used in research and life sciences applications, particularly in the study of alpha-synuclein and its role in various diseases and conditions. The PTGER1 antibody has been shown to have a high affinity for the PTGER1 antigen, making it an ideal tool for detecting and quantifying the presence of this protein in samples. Additionally, this antibody has been extensively validated for use in techniques such as immunohistochemistry, immunofluorescence, and Western blotting. Its exceptional specificity ensures reliable and accurate results, making it an invaluable asset for researchers working in the fields of neuroscience, cell biology, and molecular biology. With its ability to provide detailed insights into the expression patterns and localization of PTGER1, this antibody opens up new avenues for understanding the complex mechanisms underlying various diseases and holds great promise for future therapeutic development.
XIAP antibody
The XIAP antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and bind to X-linked inhibitor of apoptosis protein (XIAP), a glycoprotein that plays a crucial role in cell survival and death pathways. This antibody has been extensively tested and validated for its specificity and sensitivity.
SAMHD1 antibody
The SAMHD1 antibody is a neuroprotective globulin that is used in the field of Life Sciences. It is a monoclonal antibody that targets SAMHD1, an inhibitory factor involved in various cellular processes. This antibody has been shown to neutralize the activity of SAMHD1 and has potential applications in research and therapeutic development. The SAMHD1 antibody is highly specific and exhibits high affinity for its target. It can be used in various assays, including immunohistochemistry, Western blotting, and flow cytometry. This product is available as a monoclonal antibody with excipients to ensure stability and long shelf life. The SAMHD1 antibody is glycosylated, which enhances its binding efficiency and overall performance. With its unique properties, this antibody offers great potential for advancing scientific discoveries in the field of neuroprotection and beyond.
NMNAT1 antibody
NMNAT1 antibody was raised using the N terminal of NMNAT1 corresponding to a region with amino acids PVGDAYKKKGLIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVL
ATM antibody
The ATM antibody is a highly specialized monoclonal antibody that has been designed to target and bind to the ATM protein. This protein plays a crucial role in the DNA damage response pathway and is involved in cell cycle regulation, DNA repair, and apoptosis. The ATM antibody can be used in various research applications, including molecular docking studies, immunoassays, and hybridization experiments. It has been shown to specifically recognize and form a complex with the epidermal growth factor (EGF)-like domain of the ATM protein. Additionally, the ATM antibody exhibits high affinity for albumin, a major component of human serum. Its unique binding properties make it an invaluable tool for scientists working in the field of life sciences who are studying cellular processes related to DNA damage and repair.
