Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75512 products of "Primary Antibodies"
PARP11 antibody
PARP11 antibody was raised using a synthetic peptide corresponding to a region with amino acids SAFSYICENEAIPMPPHWENVNTQVPYQLIPLHNQTHEYNEVANLFGKTM
Cartilage associated protein antibody
Affinity purified Rabbit polyclonal Cartilage associated protein antibody
ZHX2 antibody
The ZHX2 antibody is a protein reagent used in Life Sciences research. It is a polyclonal antibody that specifically targets and inhibits cytokines. This antibody is widely used in various experiments and studies to investigate the role of cytokines in different biological processes. With its high specificity and potency, the ZHX2 antibody is an essential tool for researchers in the field of immunology and molecular biology. Whether you are studying immune responses, inflammation, or cell signaling pathways, this antibody can provide valuable insights into the mechanisms underlying these processes. Trust the ZHX2 antibody to deliver reliable results and contribute to advancements in scientific knowledge.
SOCS3 antibody
The SOCS3 antibody is a biomaterial protein that plays a crucial role in various biological processes. It acts as a negative regulator of cytokine signaling pathways and is involved in the regulation of growth factors. The antibody can bind to sclerostin, an important factor in bone metabolism, and inhibit its activity. Additionally, it has been shown to neutralize the effects of alpha-fetoprotein, a protein associated with liver cancer. The SOCS3 antibody is available in both polyclonal and monoclonal forms, providing researchers with options for their specific experimental needs. Its high affinity and specificity make it an invaluable tool in life sciences research.
PGD antibody
The PGD antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to alpha-fetoprotein, a protein that is associated with various diseases and conditions. The PGD antibody has been extensively tested and proven to be highly specific and sensitive in detecting alpha-fetoprotein in human serum samples. It can be used for various applications such as ELISA, Western blotting, immunohistochemistry, and flow cytometry. The PGD antibody can also be conjugated with different markers or enzymes for enhanced detection and visualization. With its high affinity and cytotoxic properties, the PGD antibody holds great potential for targeted therapy in the future.
IL8 antibody
The IL8 antibody is a highly specific antibody used in Life Sciences research. It is available as both polyclonal and monoclonal antibodies. This antibody targets IL8, which is an important chemokine involved in inflammation and immune responses. The IL8 antibody can be used for various applications, including immunohistochemistry, flow cytometry, and ELISA. It has been extensively validated and shows high sensitivity and specificity in detecting IL8 in various samples. The IL8 antibody is produced using advanced techniques to ensure high purity and activity. It is supplied as a buffered solution for easy handling and storage. Whether you are studying autoimmune diseases or investigating the role of IL8 in cancer development, the IL8 antibody is a valuable tool for your research needs.
LIF antibody
The LIF antibody is a polyclonal antibody used in the field of Life Sciences. It specifically targets and inhibits the activity of leukemia inhibitory factor (LIF), which is an important growth factor involved in various cellular processes. This antibody can be used to study the role of LIF in different biological systems, including liver microsomes and hybridoma cells. By blocking the action of LIF, this antibody can potentially have cytotoxic effects on specific cell types, such as cholinergic and catecholaminergic neurons. Additionally, it may be useful for investigating the effects of LIF inhibitors on dopamine signaling pathways. With its high specificity and potency, the LIF antibody is a valuable tool for researchers studying the function and regulation of LIF in various physiological and pathological conditions.
MST4 antibody
The MST4 antibody is a polyclonal antibody that specifically targets and binds to the triglyceride lipase known as MST4. This antibody is widely used in life sciences research to study the role of MST4 in various biological processes. It has been shown to be effective in detecting and quantifying MST4 levels in adipose tissue, as well as its involvement in signaling pathways regulated by TGF-β1. The MST4 antibody can also be used for immunohistochemistry, Western blotting, and other techniques to analyze the expression and localization of MST4 in different cell types and tissues. With its high specificity and sensitivity, this antibody is an invaluable tool for researchers studying lipase function and related diseases such as obesity and metabolic disorders.
