Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75448 products of "Primary Antibodies"
TNFR1 antibody
TNFR1 antibody is a highly specific antibody that targets the tumor necrosis factor receptor 1 (TNFR1). It binds to TNFR1 and inhibits its activity, thereby blocking the binding of TNF-α and preventing downstream signaling pathways. This antibody has been extensively studied in various fields of Life Sciences, including cancer research, immunology, and molecular biology.
STAP2 antibody
The STAP2 antibody is a highly specialized antibody that targets and neutralizes the activity of STAP2, a protein involved in various cellular processes. This polyclonal antibody is designed to specifically bind to the activated form of STAP2 and inhibit its function. By blocking the interaction between STAP2 and other proteins such as lipoprotein lipase and growth factors, this antibody helps regulate important biological pathways.
PDZK1 antibody
The PDZK1 antibody is a highly specialized molecule drug that falls under the category of antibodies in the Life Sciences field. It is designed to target a specific molecule known as PDZK1. This antibody can be used for various applications, including research and diagnostic purposes.
GNAS antibody
GNAS antibody was raised using the N terminal of GNAS corresponding to a region with amino acids SGKSTIVKQMRILHVNGFNGDSEKATKVQDIKNNLKEAIETIVAAMSNLV
AQP5 antibody
The AQP5 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to the amide form of aquaporin 5 (AQP5), a water channel protein involved in various biological processes. This antibody has been widely used to study the role of AQP5 in different cell types, including helicobacter, granulosa cells, and more. Additionally, it has shown reactivity with e-cadherin, a cell adhesion molecule that plays a crucial role in tissue organization and development. The AQP5 antibody can be utilized for immunohistochemistry, western blotting, and other experimental techniques to investigate the expression and function of AQP5 and its interaction with other proteins. Its high specificity and sensitivity make it an essential tool for researchers studying cellular mechanisms and potential therapeutic targets related to aquaporins.
Lamin B1 antibody
The Lamin B1 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It plays a crucial role in various cellular processes, including the regulation of cannabinoid receptors, TGF-beta signaling, and the differentiation of mesenchymal stem cells. This antibody has been extensively studied for its ability to inhibit phosphatase activity and modulate P2X receptors. Additionally, it has shown promising results in regulating chemokine expression and promoting pluripotent stem cell maintenance. The Lamin B1 antibody is widely recognized for its neutralizing properties and has been used in numerous studies involving ginseng, botulinum toxin, and breast cancer cell line MCF-7. Researchers trust this antibody for its high specificity and reliability in their experiments.
HAX1 antibody
The HAX1 antibody is an antiviral medication that acts as an inhibitor of methyl transferase. It plays a crucial role in the regulation of interleukin and serves as a serum marker in Life Sciences. This biomarker composition has been shown to be effective in detecting autoantibodies and is widely used in high-flux monoclonal antibody therapy. The HAX1 antibody is a potent medicament that targets specific cation channels and carnitine, making it an essential component for various medical applications. With its remarkable efficacy and versatility, the HAX1 antibody offers promising solutions for combating viral infections and promoting overall health.
SLC6A1 antibody
The SLC6A1 antibody is a highly specialized monoclonal antibody that is used in Life Sciences research. It has been specifically designed to target and bind to the SLC6A1 protein, also known as the glycine transporter 1. This protein plays a crucial role in the transport of glycine, an important neurotransmitter involved in synaptic signaling.
RPB8 antibody
The RPB8 antibody is an acidic monoclonal antibody that belongs to the colony-stimulating factor family. It is widely used in life sciences research for its ability to specifically bind to RPB8, a subunit of RNA polymerase II. This antibody has been shown to have toxic effects on cancer cells and can be used in various applications such as Western blotting, immunohistochemistry, and flow cytometry. The RPB8 antibody can also be used in combination with other antibodies, such as alpha-fetoprotein or vasoactive intestinal peptide, to study their interactions and signaling pathways. Additionally, this antibody has been shown to modulate the activity of phosphatases and interferons, making it a valuable tool for studying cellular processes and immune responses.
