Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
ARHGAP25 antibody
ARHGAP25 antibody was raised using the middle region of ARHGAP25 corresponding to a region with amino acids SPGEEASALSSQACDSKGDTLASPNSETGPGKKNSGEEEIDSLQRMVQEL
DDX3Y antibody
The DDX3Y antibody is a polyclonal antibody that has minimal toxicity and is widely used in the field of Life Sciences. It plays a crucial role in various biological processes, including colony-stimulating factor production, chemokine signaling, and immune response modulation. This antibody can be used for cytometry analysis to detect the presence of DDX3Y protein in cells or tissues.
Chlamydia trachomatis antibody (HRP)
Chlamydia trachomatis antibody (HRP) was raised in rabbit using L2 and other serovar groups as the immunogen.
SLC35F5 antibody
SLC35F5 antibody was raised using the C terminal of SLC35F5 corresponding to a region with amino acids VDREDKLDIPMFFGFVGLFNLLLLWPGFFLLHYTGFEDFEFPNKVVLMCI
CDKL3 antibody
The CDKL3 antibody is a cytotoxic monoclonal antibody that targets the oncostatin growth factor. It is commonly used in Life Sciences research to study the role of CDKL3 in various cellular processes. This antibody specifically binds to CDKL3, a protein involved in cell proliferation and differentiation. It has been shown to inhibit the growth of cancer cells by blocking the signaling pathway mediated by CDKL3. Additionally, the CDKL3 antibody has been used in hybridization studies to detect the expression of CDKL3 in different tissues and cell types. Its specificity and high affinity make it a valuable tool for researchers studying the function of CDKL3 and its potential as a therapeutic target for cancer treatment.
Cytokeratin 19 antibody
The Cytokeratin 19 antibody is a highly effective polyclonal antibody that targets and binds to Cytokeratin 19, a protein that plays a crucial role in cell adhesion and differentiation. This antibody has been extensively tested and proven to be reliable in detecting the presence of Cytokeratin 19 in various biological samples.
HIV1 gp41 antibody (biotin)
HIV1 gp41 antibody (biotin) was raised in goat using recombinant ectodomain of gp41 (glycosylated) as the immunogen.ADRB3 antibody
The ADRB3 antibody is a powerful tool used in Life Sciences research. It specifically targets the adrenergic receptor beta 3 (ADRB3), which plays a crucial role in various physiological processes. This monoclonal antibody can be used to study the function and localization of ADRB3 in different tissues and cell types.
CD100 antibody
The CD100 antibody is a monoclonal antibody that targets the erythropoietin receptor. It has been widely used in the field of Life Sciences for various applications. This antibody specifically binds to the erythropoietin receptor, which plays a crucial role in red blood cell production and differentiation. By targeting this receptor, the CD100 antibody can modulate erythropoiesis and potentially have therapeutic effects on conditions related to red blood cell disorders.
UBE2J2 antibody
UBE2J2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GIQLLNGHAPGAVPNLAGLQQANRHHGLLGGALANLFVIVGFAAFAYTVK
Beta Tubulin 2A antibody
Beta Tubulin 2A antibody was raised using the middle region of TUBB2A corresponding to a region with amino acids AVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAAC
PLD3 antibody
PLD3 antibody was raised using the N terminal of PLD3 corresponding to a region with amino acids WVLLVLILAVVGFGALMTQLFLWEYGDLHLFGPNQRPAPCYDPCEAVLVE
Purity:Min. 95%
