Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
ADRA2A antibody
The ADRA2A antibody is a powerful tool used in Life Sciences research. It specifically targets the ADRA2A protein, which plays a crucial role in various physiological processes such as influenza hemagglutinin binding and glucose-6-phosphate metabolism. This antibody has been extensively studied and validated for its specificity and sensitivity.
GPX7 antibody
The GPX7 antibody is a highly specialized monoclonal antibody that is used in various Life Sciences applications. It is specifically designed to target and neutralize GPX7, an enzyme that plays a crucial role in the regulation of oxidative stress. The antibody has been extensively tested and validated for its efficacy in laboratory experiments.
PSMB4 antibody
PSMB4 antibody was raised using a synthetic peptide corresponding to a region with amino acids SRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSLATGYGAYLAQ
BARHL2 antibody
The BARHL2 antibody is a highly specialized product used in the field of Life Sciences. It plays a crucial role in various biological processes, including the regulation of dopamine and nuclear receptor signaling pathways. This antibody has been extensively studied and proven to be effective in blocking the interaction between domperidone and metoclopramide with their respective receptors.
LYRM1 antibody
LYRM1 antibody was raised using the middle region of LYRM1 corresponding to a region with amino acids KEKQYILNEARTLFRKNKNLTDTDLIKQCIDECTARIEIGLHYKIPYPRP
Bcl-2 antibody
The Bcl-2 antibody is a powerful tool in the field of immunology. It belongs to the class of polyclonal antibodies and monoclonal antibodies, which are widely used for their neutralizing and cytotoxic effects. This antibody specifically targets Bcl-2, a protein that plays a critical role in regulating cell death (apoptosis). By binding to Bcl-2, this antibody can interfere with its function and induce cell death in cancer cells.
MLSTD2 antibody
MLSTD2 antibody was raised using the N terminal Of Mlstd2 corresponding to a region with amino acids LRSCPKVNSVYVLVRQKAGQTPQERVEEVLSGKLFDRLRDENPDFREKII
PRDX6 antibody
The PRDX6 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It specifically targets and binds to the protein peroxiredoxin 6 (PRDX6), which plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to be effective in research involving cholinergic signaling, electrode development, and protein kinase studies.
SYNCRIP antibody
The SYNCRIP antibody is a protein-based product that falls under the category of antibodies. It is specifically designed for use in life sciences research and has potential therapeutic applications. This polyclonal antibody is highly effective in targeting and binding to the SYNCRIP protein, enabling researchers to study its functions and interactions within cells. With its high specificity and sensitivity, this antibody is an invaluable tool for scientists working in various fields such as molecular biology, cell biology, and biochemistry. Whether you are investigating gene expression regulation or studying protein-protein interactions, the SYNCRIP antibody is a reliable choice that will help advance your research efforts.
