Primary Antibodies

INTS8 antibody was raised in Rabbit using Human INTS8 as the immunogen

Rabbit polyclonal Clofibrate antibody

EIF6 antibody was raised in rabbit using the C terminal of EIF6 as the immunogen

GRIN1 antibody was raised in Rabbit using Human GRIN1 as the immunogen

IL4 antibody is a glycoprotein that belongs to the class of monoclonal antibodies. It is commonly used in life sciences research and has various applications in the field. IL4 antibody can be used as a tool to study the role of interleukin-4 (IL-4) in immune responses and inflammation. It can also be used as an inhibitor to block the activity of IL-4, which is involved in anti-angiogenesis and other processes.

The CDC45L antibody is a highly specialized monoclonal antibody that targets the CDC45L protein. This protein plays an important role in various biological processes, including DNA replication and cell cycle regulation. By specifically binding to CDC45L, this antibody can effectively inhibit its function and disrupt these processes.

AFP antibody was raised in Rabbit using Human AFP as the immunogen

Rabbit polyclonal PPT1 antibody

IL16 antibody is a highly effective polyclonal antibody that specifically targets IL16, a cytokine involved in immune response regulation. This antibody recognizes and binds to the amino group of IL16, neutralizing its activity and preventing it from interacting with its receptors. The IL16 antibody can be used in various research applications, including immunohistochemistry, Western blotting, and flow cytometry. It has been shown to inhibit the growth and proliferation of mesenchymal stem cells and has potential therapeutic applications in cancer treatment. Additionally, this antibody has been used as a tool in studying the role of IL16 in diseases such as asthma, rheumatoid arthritis, and HIV infection. With its high specificity and effectiveness, the IL16 antibody is a valuable tool for researchers in the life sciences field.

The Notch 1 antibody is a substance used in Life Sciences research and development. It is specifically designed to target and bind to the Notch 1 antigen, which plays a crucial role in cell signaling and development. By inhibiting the activity of Notch 1, this antibody can help researchers gain a better understanding of various biological processes.

Haptoglobin antibody is a monoclonal antibody that specifically targets haptoglobin, a human protein found in plasma. It is widely used in Life Sciences research to study the role of haptoglobin in various biological processes. Haptoglobin antibody has been shown to bind to haptoglobin expressed in human hepatocytes and inhibit its function. This antibody can also be used for immunohistochemistry and Western blotting to detect haptoglobin levels in human serum samples. Additionally, haptoglobin antibody has been used in studies investigating the interaction between haptoglobin and other molecules such as fatty acids, lectins, and transport proteins. Its specificity and high affinity make it a valuable tool for researchers studying the functions of haptoglobin and its polymorphic variants.

The FPR1 antibody is a highly specialized medicament used in Life Sciences research. It is a monoclonal antibody that specifically targets and binds to e-cadherin, a glycoprotein involved in cell adhesion. This colloidal antibody has been extensively studied for its inhibitory effects on e-cadherin expression and its potential as a therapeutic agent in various diseases.

The MCM7 antibody is a highly specialized antibody that targets the lipoprotein lipase, an enzyme involved in the breakdown of triglycerides. This polyclonal antibody is widely used in the field of Life Sciences for research purposes and has shown great potential as an antibiotic. It specifically binds to the lipoprotein lipase, inhibiting its activity and preventing the breakdown of triglycerides. Additionally, this antibody has been found to have growth factor-like properties, promoting cell proliferation and differentiation. The MCM7 antibody is available as both monoclonal and polyclonal antibodies, allowing researchers to choose the most suitable option for their experiments. Its high specificity and cytotoxic effects make it a valuable tool in studying adipose tissue metabolism, collagen synthesis, and TGF-beta signaling pathways.

GALK1 antibody was raised in Rabbit using Human GALK1 as the immunogen

The FAST antibody is a hormone peptide that plays a crucial role in various biological processes. This antibody specifically targets multidrug resistance-associated protein (MRP), which is involved in drug resistance mechanisms in cancer cells. The FAST antibody has been extensively studied and has shown promising results in inducing apoptosis (cell death) in cancer cells by targeting MRP. It is available as both polyclonal and monoclonal antibodies, providing researchers with options for their specific experimental needs. Additionally, the FAST antibody can be used in various applications such as immunohistochemistry, Western blotting, and flow cytometry. Its ability to specifically bind to MRP makes it a valuable tool for studying drug resistance mechanisms and developing novel therapeutic strategies against cancer.

CYP2A13 antibody was raised using the C terminal of CYP2A13 corresponding to a region with amino acids DPRFFSNPRDFNPQHFLDKKGQFKKSDAFVPFSIGKRYCFGEGLARMELF

LNX1 antibody was raised using the C terminal of LNX1 corresponding to a region with amino acids SHREWDLPIYVISVEPGGVISRDGRIKTGDILLNVDGVELTEVSRSEAVA

ERC2 antibody was raised in Rabbit using Human ERC2 as the immunogen

RBM39 antibody was raised using the N terminal of RBM39 corresponding to a region with amino acids ADDIDIEAMLEAPYKKDENKLSSANGHEERSKKRKKSKSRSRSHERKRSK