Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
HNRPAB antibody
HNRPAB antibody was raised using the N terminal Of Hnrpab corresponding to a region with amino acids GAAAGAGGATAAPPSGNQNGAEGDQINASKNEEDAGKMFVGGLSWDTSKKCRSP7 antibody
CRSP7 antibody was raised in mouse using recombinant Human Cofactor Required For Sp1 Transcriptional Activation, Subunit 7, 70Kda (Crsp7)Goat anti Human IgE (epsilon chain) (HRP)
Goat anti-Human IgE (epsilon chain) (HRP) was raised in goat using purified Human IgE as the immunogen.APP antibody
The APP antibody is a powerful tool for researchers studying various proteins and growth factors involved in cellular processes. This monoclonal antibody specifically targets the amyloid precursor protein (APP) and can be used in a variety of applications.CSK antibody
CSK antibody was raised in Mouse using a purified recombinant fragment of human CSK expressed in E. coli as the immunogen.RPL4 antibody
The RPL4 antibody is a protein that specifically targets and neutralizes collagen. It belongs to the class of polyclonal antibodies, which are widely used in life sciences research. This antibody has been shown to inhibit the activity of hepatocyte growth factor and epidermal growth factor, both of which play crucial roles in cell proliferation and tissue regeneration. The RPL4 antibody is available as both low-molecular-weight dimers and monoclonal antibodies, allowing for various applications in research and diagnostics. It can be immobilized using chromatographic techniques or activated for specific binding assays.
CCL2 antibody
The CCL2 antibody is a powerful immunomodulatory agent that has cytotoxic properties. It belongs to the class of antibodies and is known for its reactive nature against cancer cells. In the field of Life Sciences, this antibody is widely recognized for its potential as an anticancer agent. It has been shown to be effective in inhibiting the growth and proliferation of cancer cells, particularly in HL-60 cell lines. The CCL2 antibody can also activate interferon and other growth factors, leading to enhanced immune response against cancer cells. Additionally, this antibody has antiviral properties and can neutralize binding proteins involved in viral infections. With its multidrug capabilities, the CCL2 antibody holds great promise in the field of cancer research and immunotherapy.SETDB2 antibody
SETDB2 antibody was raised using the N terminal of SETDB2 corresponding to a region with amino acids ASQKEVNAQSSDPMPVTQKEQENKSNAFPSTSCENSFPEDCTFLTTGNKECD3 antibody
CD3 antibody is a monoclonal antibody that targets the CD3 antigen on T cells. It is commonly used in research and clinical settings to study T cell function and activation. The CD3 antibody binds to the CD3 complex, which consists of multiple subunits including the CD3γ, δ, ε, and ζ chains. This binding activates T cells and initiates a cascade of signaling events that lead to T cell activation and proliferation.
NRBP2 antibody
NRBP2 antibody was raised using the middle region of NRBP2 corresponding to a region with amino acids VIQMQCNLERSEDKARWHLTLLLVLEDRLHRQLTYDLLPTDSAQDLASELCry1 antibody
The Cry1 antibody is a monoclonal antibody that has neutralizing properties against the interferon-galectin-3-binding complex. This antibody specifically targets and binds to the Cry1 protein produced by Bacillus thuringiensis, inhibiting its endocytic uptake into cells. The Cry1 antibody also has a high affinity for fatty acids and collagen, making it an effective agent for blocking their interaction with target molecules. Additionally, this monoclonal antibody has been shown to inhibit phosphatase activity and reduce low-density lipoprotein (LDL) levels in vitro. With its versatile properties, the Cry1 antibody holds great potential for therapeutic applications in various fields of research and medicine.
